Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2I0Q1

Protein Details
Accession A0A1X2I0Q1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-81LTWQCPKKNCCNRSKKSLRTESFFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, mito_nucl 9.166, cyto 7, mito 3.5
Family & Domain DBs
Amino Acid Sequences MTSNPDIWEITSICRNKEETLRWLIQQNVFYNTTTGFGIMVCRSGEQMNIVSSGVRGLTWQCPKKNCCNRSKKSLRTESFFYNLKAPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.28
4 0.34
5 0.36
6 0.34
7 0.39
8 0.39
9 0.38
10 0.4
11 0.4
12 0.37
13 0.36
14 0.33
15 0.3
16 0.29
17 0.27
18 0.24
19 0.2
20 0.18
21 0.14
22 0.12
23 0.07
24 0.06
25 0.07
26 0.07
27 0.08
28 0.06
29 0.06
30 0.07
31 0.07
32 0.08
33 0.07
34 0.08
35 0.07
36 0.08
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.05
44 0.06
45 0.13
46 0.22
47 0.28
48 0.33
49 0.4
50 0.45
51 0.55
52 0.64
53 0.66
54 0.68
55 0.73
56 0.76
57 0.8
58 0.86
59 0.84
60 0.84
61 0.86
62 0.81
63 0.76
64 0.75
65 0.69
66 0.64
67 0.58
68 0.5