Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PKD5

Protein Details
Accession B8PKD5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-36TRGFASHKRSCRRKLEEKKRDAEVBasic
43-62LKLAKQKKKGKGQQGKPNLHBasic
NLS Segment(s)
PositionSequence
24-32RRKLEEKKR
42-55ALKLAKQKKKGKGQ
Subcellular Location(s) mito 19, cyto 4.5, cyto_nucl 4, nucl 2.5
Family & Domain DBs
KEGG ppl:POSPLDRAFT_93002  -  
Amino Acid Sequences MAECPICGLLWDTRGFASHKRSCRRKLEEKKRDAEVLRDIEALKLAKQKKKGKGQQGKPNLHQIPSMVLLHYIPHIIFQPMLQVQMQMNLVHHFNMLIYQTTCLVSAEMLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.22
4 0.3
5 0.34
6 0.42
7 0.51
8 0.6
9 0.66
10 0.74
11 0.78
12 0.8
13 0.84
14 0.87
15 0.87
16 0.87
17 0.83
18 0.77
19 0.74
20 0.64
21 0.56
22 0.51
23 0.44
24 0.36
25 0.32
26 0.28
27 0.22
28 0.23
29 0.19
30 0.14
31 0.18
32 0.22
33 0.25
34 0.34
35 0.42
36 0.49
37 0.59
38 0.65
39 0.69
40 0.74
41 0.79
42 0.79
43 0.81
44 0.78
45 0.7
46 0.72
47 0.62
48 0.53
49 0.44
50 0.35
51 0.27
52 0.24
53 0.21
54 0.12
55 0.11
56 0.1
57 0.1
58 0.1
59 0.08
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.11
67 0.11
68 0.12
69 0.12
70 0.12
71 0.12
72 0.15
73 0.16
74 0.12
75 0.13
76 0.14
77 0.14
78 0.13
79 0.13
80 0.1
81 0.09
82 0.1
83 0.11
84 0.12
85 0.12
86 0.13
87 0.14
88 0.15
89 0.15
90 0.13
91 0.12