Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2IG64

Protein Details
Accession A0A1X2IG64    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
51-70CRNLRKTKQVHIKCLCHKKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 14, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences MVYITDDEGTVRKFACLTCIKGHRSSGCQHADRELVEIRKKGRPLTQCAHCRNLRKTKQVHIKCLCHKKSDGKYITT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.19
3 0.21
4 0.24
5 0.3
6 0.37
7 0.4
8 0.42
9 0.46
10 0.42
11 0.41
12 0.4
13 0.4
14 0.4
15 0.39
16 0.36
17 0.34
18 0.33
19 0.29
20 0.29
21 0.24
22 0.21
23 0.21
24 0.23
25 0.23
26 0.25
27 0.26
28 0.26
29 0.3
30 0.31
31 0.35
32 0.41
33 0.47
34 0.52
35 0.55
36 0.6
37 0.58
38 0.61
39 0.63
40 0.66
41 0.65
42 0.65
43 0.66
44 0.69
45 0.75
46 0.75
47 0.76
48 0.74
49 0.76
50 0.77
51 0.83
52 0.77
53 0.72
54 0.7
55 0.7
56 0.7
57 0.72