Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IW21

Protein Details
Accession A0A1X2IW21    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
84-116LLDEKKQKQKTTKPSNRQFHRKKNRDAIKLENFHydrophilic
NLS Segment(s)
PositionSequence
91-108KQKTTKPSNRQFHRKKNR
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSLVRQNLQRHVRVQRSCLHSSSFTLSNQTASSSAIEGTTSAQPRKPSSVAAGTTLSGINFLKDGKDPVALEDNEYPMWLWDLLDEKKQKQKTTKPSNRQFHRKKNRDAIKLENFMKDKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.58
4 0.58
5 0.57
6 0.52
7 0.47
8 0.39
9 0.38
10 0.38
11 0.33
12 0.26
13 0.27
14 0.25
15 0.23
16 0.21
17 0.19
18 0.15
19 0.13
20 0.13
21 0.1
22 0.1
23 0.08
24 0.08
25 0.07
26 0.09
27 0.12
28 0.14
29 0.15
30 0.17
31 0.2
32 0.22
33 0.26
34 0.25
35 0.21
36 0.22
37 0.25
38 0.23
39 0.23
40 0.22
41 0.18
42 0.17
43 0.16
44 0.12
45 0.09
46 0.08
47 0.06
48 0.06
49 0.05
50 0.06
51 0.06
52 0.08
53 0.07
54 0.09
55 0.09
56 0.11
57 0.16
58 0.15
59 0.17
60 0.17
61 0.17
62 0.15
63 0.15
64 0.13
65 0.08
66 0.09
67 0.07
68 0.06
69 0.06
70 0.1
71 0.12
72 0.18
73 0.22
74 0.25
75 0.33
76 0.38
77 0.43
78 0.48
79 0.57
80 0.61
81 0.7
82 0.77
83 0.79
84 0.85
85 0.9
86 0.9
87 0.92
88 0.91
89 0.91
90 0.92
91 0.9
92 0.9
93 0.9
94 0.9
95 0.88
96 0.83
97 0.82
98 0.8
99 0.79
100 0.72
101 0.69
102 0.62