Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IQ76

Protein Details
Accession A0A1X2IQ76   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
244-267GEENSDARKRRRKKLGPNDRNVVLHydrophilic
NLS Segment(s)
PositionSequence
251-258RKRRRKKL
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039301  Sip5/DA2  
Amino Acid Sequences MGIQTSKLDSTYPPITTKKKSHVGGNNSGTSSSGSGGGQLEYGSLLPQDIYPSSTCDYDVKAVRKFIKEGLLAPFFIGLNEAPAGPAPVGSAQPPYHTTTTPPDTSTITQQSSPTTQSPKSNQNTASMAIMRNKIKDRLLLLRSSSTCQQTDQLLYNNTIECPICLLTYPDCVNCTRCCDKPICTDCFLQLRRSDESPLVPAACPFCVQPNLGVIHFPPRWSHQHEIFKQKRPDLFILWEHELGEENSDARKRRRKKLGPNDRNVVLVDQIRPNWQDQLDLKGHHRHQYHHHQQQQQHAYQTYVVESQLHGGHRRNRRRLSGSLSGSGTTRRIIVRPTMQTSLTSRTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.49
4 0.56
5 0.58
6 0.62
7 0.63
8 0.68
9 0.7
10 0.71
11 0.73
12 0.72
13 0.67
14 0.58
15 0.54
16 0.45
17 0.37
18 0.29
19 0.2
20 0.15
21 0.11
22 0.12
23 0.13
24 0.12
25 0.11
26 0.1
27 0.09
28 0.08
29 0.08
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.09
36 0.09
37 0.11
38 0.11
39 0.15
40 0.16
41 0.16
42 0.17
43 0.17
44 0.18
45 0.22
46 0.28
47 0.3
48 0.32
49 0.38
50 0.42
51 0.44
52 0.44
53 0.41
54 0.41
55 0.37
56 0.36
57 0.37
58 0.33
59 0.3
60 0.28
61 0.26
62 0.19
63 0.17
64 0.15
65 0.08
66 0.08
67 0.08
68 0.08
69 0.07
70 0.07
71 0.08
72 0.06
73 0.07
74 0.06
75 0.06
76 0.07
77 0.08
78 0.12
79 0.11
80 0.14
81 0.16
82 0.2
83 0.21
84 0.21
85 0.23
86 0.26
87 0.31
88 0.3
89 0.28
90 0.26
91 0.27
92 0.28
93 0.31
94 0.28
95 0.24
96 0.24
97 0.24
98 0.25
99 0.24
100 0.26
101 0.24
102 0.24
103 0.25
104 0.3
105 0.34
106 0.41
107 0.43
108 0.45
109 0.43
110 0.42
111 0.41
112 0.36
113 0.33
114 0.25
115 0.24
116 0.21
117 0.25
118 0.23
119 0.25
120 0.26
121 0.27
122 0.27
123 0.28
124 0.27
125 0.3
126 0.31
127 0.3
128 0.29
129 0.3
130 0.3
131 0.3
132 0.3
133 0.25
134 0.23
135 0.21
136 0.21
137 0.19
138 0.2
139 0.19
140 0.19
141 0.17
142 0.18
143 0.18
144 0.17
145 0.15
146 0.14
147 0.12
148 0.09
149 0.09
150 0.08
151 0.07
152 0.06
153 0.08
154 0.07
155 0.1
156 0.11
157 0.1
158 0.11
159 0.12
160 0.14
161 0.14
162 0.2
163 0.2
164 0.21
165 0.23
166 0.24
167 0.27
168 0.34
169 0.39
170 0.36
171 0.36
172 0.35
173 0.35
174 0.4
175 0.38
176 0.31
177 0.29
178 0.28
179 0.28
180 0.29
181 0.28
182 0.22
183 0.21
184 0.2
185 0.18
186 0.16
187 0.13
188 0.13
189 0.12
190 0.11
191 0.1
192 0.09
193 0.1
194 0.11
195 0.11
196 0.11
197 0.13
198 0.15
199 0.14
200 0.14
201 0.12
202 0.18
203 0.18
204 0.18
205 0.16
206 0.19
207 0.25
208 0.3
209 0.35
210 0.36
211 0.46
212 0.51
213 0.61
214 0.63
215 0.67
216 0.67
217 0.66
218 0.61
219 0.56
220 0.53
221 0.45
222 0.43
223 0.37
224 0.37
225 0.35
226 0.32
227 0.27
228 0.24
229 0.22
230 0.18
231 0.16
232 0.1
233 0.09
234 0.11
235 0.15
236 0.19
237 0.25
238 0.35
239 0.42
240 0.52
241 0.63
242 0.7
243 0.78
244 0.85
245 0.89
246 0.9
247 0.9
248 0.86
249 0.76
250 0.67
251 0.57
252 0.46
253 0.38
254 0.3
255 0.24
256 0.21
257 0.21
258 0.23
259 0.24
260 0.24
261 0.25
262 0.23
263 0.25
264 0.24
265 0.3
266 0.3
267 0.31
268 0.34
269 0.39
270 0.42
271 0.44
272 0.45
273 0.42
274 0.48
275 0.56
276 0.63
277 0.64
278 0.69
279 0.7
280 0.72
281 0.78
282 0.78
283 0.7
284 0.65
285 0.56
286 0.49
287 0.43
288 0.39
289 0.31
290 0.23
291 0.2
292 0.15
293 0.14
294 0.15
295 0.17
296 0.19
297 0.22
298 0.28
299 0.36
300 0.46
301 0.56
302 0.63
303 0.68
304 0.74
305 0.76
306 0.76
307 0.75
308 0.75
309 0.69
310 0.64
311 0.58
312 0.49
313 0.44
314 0.4
315 0.33
316 0.24
317 0.22
318 0.19
319 0.2
320 0.23
321 0.3
322 0.36
323 0.42
324 0.47
325 0.47
326 0.46
327 0.47
328 0.47