Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2J1W3

Protein Details
Accession A0A1X2J1W3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-118SAISTSFKKKSKKTSKKGKKQAKKHydrophilic
NLS Segment(s)
PositionSequence
102-118KKKSKKTSKKGKKQAKK
Subcellular Location(s) plas 11, mito 5, pero 3, E.R. 3, vacu 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013945  Pkr1  
Gene Ontology GO:0016020  C:membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF08636  Pkr1  
Amino Acid Sequences MELDTSTEGGLVNDIITSIMTPGYTATGVIQAMFYAFYALFATLTIMVIITGGNPHVIALLLLSVCLFIAIRWFLAELDNIKRQNGETTKDRDASAISTSFKKKSKKTSKKGKKQAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.06
14 0.08
15 0.08
16 0.08
17 0.07
18 0.06
19 0.06
20 0.06
21 0.05
22 0.05
23 0.04
24 0.05
25 0.05
26 0.06
27 0.05
28 0.05
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.02
53 0.03
54 0.03
55 0.02
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.08
64 0.09
65 0.13
66 0.19
67 0.19
68 0.19
69 0.2
70 0.2
71 0.26
72 0.27
73 0.28
74 0.29
75 0.35
76 0.4
77 0.41
78 0.41
79 0.33
80 0.31
81 0.28
82 0.24
83 0.21
84 0.19
85 0.23
86 0.26
87 0.32
88 0.37
89 0.44
90 0.48
91 0.56
92 0.66
93 0.71
94 0.78
95 0.84
96 0.89
97 0.92
98 0.96