Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IMI5

Protein Details
Accession A0A1X2IMI5   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
63-93ARPSKTKQDQARPSKNKQIKQDQARTSKNKQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MFRSPLSPSRDELTKIVTLHIGCVKSSPKEKPTINLQAPYEPLKQARNKQVQTSPNKSKQVQARPSKTKQDQARPSKNKQIKQDQARTSKNKQIKQRHLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.27
4 0.26
5 0.22
6 0.22
7 0.25
8 0.21
9 0.17
10 0.19
11 0.21
12 0.23
13 0.29
14 0.31
15 0.31
16 0.38
17 0.39
18 0.41
19 0.46
20 0.51
21 0.49
22 0.47
23 0.44
24 0.39
25 0.39
26 0.39
27 0.32
28 0.23
29 0.22
30 0.24
31 0.28
32 0.33
33 0.4
34 0.45
35 0.45
36 0.48
37 0.52
38 0.54
39 0.57
40 0.59
41 0.58
42 0.57
43 0.61
44 0.57
45 0.56
46 0.57
47 0.59
48 0.6
49 0.62
50 0.63
51 0.66
52 0.71
53 0.75
54 0.71
55 0.7
56 0.68
57 0.69
58 0.7
59 0.73
60 0.78
61 0.76
62 0.79
63 0.81
64 0.81
65 0.77
66 0.76
67 0.77
68 0.75
69 0.78
70 0.81
71 0.79
72 0.81
73 0.84
74 0.82
75 0.78
76 0.78
77 0.76
78 0.74
79 0.75
80 0.77