Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IEV7

Protein Details
Accession A0A1X2IEV7   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-51IPGKYLRYFKPKKNKSITPEHKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR015946  KH_dom-like_a/b  
IPR000238  RbfA  
IPR023799  RbfA_dom_sf  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF02033  RBFA  
Amino Acid Sequences MFLIKRTLTTLPKTAARKPQLDQVQDVMIPGKYLRYFKPKKNKSITPEHKEAWHHDSSRHLELHTETARPLQGHELDAAPTVMQERLAQRIHRALSTVYSVEVLPTPLITQAHLTLRHVKISRNLKKCYIFYEPTSPSKKERGEVHRALTSYLPMLNTLIKNHAQLRKPLSIKFVSDTQSKELDAIYDRLALELKDTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.57
4 0.57
5 0.53
6 0.58
7 0.59
8 0.58
9 0.53
10 0.45
11 0.41
12 0.36
13 0.34
14 0.26
15 0.18
16 0.15
17 0.13
18 0.14
19 0.14
20 0.18
21 0.22
22 0.31
23 0.39
24 0.48
25 0.59
26 0.64
27 0.71
28 0.77
29 0.8
30 0.76
31 0.8
32 0.81
33 0.78
34 0.76
35 0.68
36 0.63
37 0.58
38 0.56
39 0.51
40 0.46
41 0.39
42 0.34
43 0.39
44 0.39
45 0.41
46 0.37
47 0.3
48 0.26
49 0.26
50 0.32
51 0.26
52 0.22
53 0.18
54 0.19
55 0.2
56 0.18
57 0.18
58 0.15
59 0.15
60 0.15
61 0.15
62 0.14
63 0.13
64 0.13
65 0.12
66 0.08
67 0.06
68 0.07
69 0.06
70 0.05
71 0.07
72 0.07
73 0.12
74 0.14
75 0.15
76 0.16
77 0.2
78 0.2
79 0.19
80 0.19
81 0.14
82 0.14
83 0.14
84 0.13
85 0.09
86 0.09
87 0.08
88 0.08
89 0.07
90 0.07
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.06
97 0.06
98 0.08
99 0.11
100 0.12
101 0.14
102 0.2
103 0.2
104 0.25
105 0.26
106 0.26
107 0.31
108 0.41
109 0.49
110 0.49
111 0.51
112 0.52
113 0.56
114 0.55
115 0.52
116 0.49
117 0.42
118 0.38
119 0.43
120 0.41
121 0.43
122 0.47
123 0.44
124 0.4
125 0.45
126 0.44
127 0.41
128 0.46
129 0.47
130 0.51
131 0.53
132 0.54
133 0.51
134 0.49
135 0.45
136 0.36
137 0.29
138 0.21
139 0.18
140 0.14
141 0.11
142 0.11
143 0.14
144 0.15
145 0.15
146 0.18
147 0.18
148 0.22
149 0.28
150 0.34
151 0.34
152 0.39
153 0.44
154 0.49
155 0.5
156 0.49
157 0.49
158 0.45
159 0.44
160 0.41
161 0.39
162 0.34
163 0.36
164 0.36
165 0.34
166 0.33
167 0.31
168 0.28
169 0.23
170 0.21
171 0.2
172 0.19
173 0.17
174 0.17
175 0.17
176 0.17
177 0.18
178 0.16