Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2I6T4

Protein Details
Accession A0A1X2I6T4   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
102-123QGASTASKSSKKKKSNKKKGGKHydrophilic
NLS Segment(s)
PositionSequence
109-123KSSKKKKSNKKKGGK
Subcellular Location(s) nucl 19, cyto_nucl 13.833, cyto 6.5, cyto_pero 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MYITNWDDFQKAAEDIFTSSPDNTRYVHAFHGSQGELVLKVTNDQMIVKYKTNQATDLKKFIGMNELFMSKMQNKAMDIDEPVAEVPATTSPNPADSPQIPQGASTASKSSKKKKSNKKKGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.15
5 0.13
6 0.13
7 0.16
8 0.17
9 0.18
10 0.17
11 0.19
12 0.19
13 0.19
14 0.22
15 0.22
16 0.21
17 0.2
18 0.23
19 0.2
20 0.18
21 0.16
22 0.14
23 0.11
24 0.11
25 0.11
26 0.07
27 0.07
28 0.08
29 0.08
30 0.07
31 0.07
32 0.09
33 0.14
34 0.17
35 0.18
36 0.2
37 0.24
38 0.28
39 0.29
40 0.3
41 0.3
42 0.35
43 0.36
44 0.37
45 0.32
46 0.29
47 0.28
48 0.25
49 0.27
50 0.19
51 0.18
52 0.16
53 0.16
54 0.14
55 0.14
56 0.16
57 0.1
58 0.13
59 0.12
60 0.13
61 0.13
62 0.15
63 0.16
64 0.15
65 0.15
66 0.13
67 0.12
68 0.11
69 0.11
70 0.09
71 0.07
72 0.06
73 0.06
74 0.07
75 0.09
76 0.09
77 0.11
78 0.11
79 0.13
80 0.15
81 0.15
82 0.18
83 0.17
84 0.23
85 0.26
86 0.28
87 0.26
88 0.25
89 0.25
90 0.22
91 0.23
92 0.19
93 0.19
94 0.21
95 0.29
96 0.37
97 0.46
98 0.53
99 0.62
100 0.71
101 0.78
102 0.84
103 0.88