Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PG47

Protein Details
Accession B8PG47    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-36EVPETLLKKRKQNEKAREERLAAHydrophilic
NLS Segment(s)
PositionSequence
21-54KKRKQNEKAREERLAAATAARKAAKAKRKVIFKR
Subcellular Location(s) nucl 11, cyto 10, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR018038  Ribosomal_L30_CS  
IPR016082  Ribosomal_L30_ferredoxin-like  
IPR012988  Ribosomal_L30_N  
IPR039699  Ribosomal_L7/L30  
IPR005998  Ribosomal_L7_euk  
IPR035808  Ribosomal_L7_euk_arc  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ppl:POSPLDRAFT_120666  -  
ppl:POSPLDRAFT_121260  -  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
PF08079  Ribosomal_L30_N  
PROSITE View protein in PROSITE  
PS00634  RIBOSOMAL_L30  
CDD cd01657  Ribosomal_L7_archeal_euk  
Amino Acid Sequences MAPSTTVPSVADVEVPETLLKKRKQNEKAREERLAAATAARKAAKAKRKVIFKRAEAYVKEYLSQEKEEIRLKRAARSTGDFYVPAQAKVYFVIRIRGINEIAPKPRKILQLLRLLQINNGVFVKVTKATEQMLRLVEPYVAYGEPNLKSVRELIYKRGYGKVDKQRIPLTNNGVIEETLSKYDILSVEDLVHEIFTAGPNFKQASNFLWPFKLSNPTGGWRIRKFKHFVQGGDFGNREENINKLIRQMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.12
5 0.17
6 0.24
7 0.29
8 0.35
9 0.44
10 0.54
11 0.63
12 0.72
13 0.79
14 0.81
15 0.86
16 0.85
17 0.83
18 0.75
19 0.69
20 0.6
21 0.51
22 0.41
23 0.34
24 0.3
25 0.25
26 0.26
27 0.22
28 0.21
29 0.25
30 0.33
31 0.39
32 0.44
33 0.51
34 0.54
35 0.65
36 0.72
37 0.76
38 0.76
39 0.72
40 0.7
41 0.66
42 0.66
43 0.57
44 0.55
45 0.5
46 0.42
47 0.39
48 0.33
49 0.31
50 0.27
51 0.27
52 0.23
53 0.2
54 0.23
55 0.28
56 0.29
57 0.29
58 0.33
59 0.33
60 0.38
61 0.4
62 0.4
63 0.37
64 0.4
65 0.41
66 0.37
67 0.37
68 0.31
69 0.27
70 0.3
71 0.27
72 0.22
73 0.19
74 0.16
75 0.15
76 0.16
77 0.17
78 0.12
79 0.12
80 0.15
81 0.15
82 0.16
83 0.17
84 0.18
85 0.17
86 0.16
87 0.2
88 0.2
89 0.25
90 0.28
91 0.27
92 0.27
93 0.32
94 0.33
95 0.32
96 0.36
97 0.36
98 0.43
99 0.44
100 0.43
101 0.41
102 0.37
103 0.33
104 0.31
105 0.23
106 0.14
107 0.13
108 0.11
109 0.09
110 0.09
111 0.1
112 0.08
113 0.08
114 0.08
115 0.09
116 0.1
117 0.13
118 0.13
119 0.15
120 0.14
121 0.13
122 0.13
123 0.13
124 0.12
125 0.09
126 0.09
127 0.07
128 0.06
129 0.06
130 0.06
131 0.09
132 0.09
133 0.12
134 0.12
135 0.11
136 0.11
137 0.13
138 0.16
139 0.19
140 0.2
141 0.24
142 0.29
143 0.32
144 0.33
145 0.36
146 0.35
147 0.32
148 0.41
149 0.45
150 0.48
151 0.5
152 0.53
153 0.54
154 0.56
155 0.55
156 0.51
157 0.47
158 0.42
159 0.39
160 0.35
161 0.3
162 0.25
163 0.23
164 0.19
165 0.14
166 0.1
167 0.1
168 0.09
169 0.08
170 0.1
171 0.1
172 0.1
173 0.1
174 0.1
175 0.09
176 0.1
177 0.1
178 0.08
179 0.08
180 0.06
181 0.05
182 0.05
183 0.06
184 0.08
185 0.09
186 0.09
187 0.12
188 0.13
189 0.14
190 0.16
191 0.16
192 0.19
193 0.26
194 0.29
195 0.28
196 0.29
197 0.29
198 0.29
199 0.31
200 0.34
201 0.26
202 0.29
203 0.3
204 0.32
205 0.37
206 0.42
207 0.46
208 0.46
209 0.55
210 0.55
211 0.6
212 0.62
213 0.63
214 0.67
215 0.65
216 0.6
217 0.57
218 0.59
219 0.54
220 0.54
221 0.47
222 0.38
223 0.36
224 0.34
225 0.3
226 0.24
227 0.23
228 0.22
229 0.25
230 0.25