Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YA81

Protein Details
Accession A0A1Y1YA81   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
204-229QRAAKDAAKGKKKTKKTTATIKQVDAHydrophilic
NLS Segment(s)
PositionSequence
56-82VAAPAKPKKIPLAEKIRMRQEEEEKRK
205-219RAAKDAAKGKKKTKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023194  eIF3-like_dom_sf  
IPR013906  eIF3j  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
Pfam View protein in Pfam  
PF08597  eIF3_subunit  
Amino Acid Sequences MSDWEKEDFDEVPAVVVAKTGKFWDDEDEDSDGVKDNWDDSDSEAEEEEEKKAAPVAAPAKPKKIPLAEKIRMRQEEEEKRKQQIAEKKAAMAGDEDAAARRARLQALEVEADIENATDLFSGVSVKDTEVGNKLTRLQPKTKEEFDEFSTVLLERINSTSKQVRPTVYMGFLEGFVRELASPLKDVEVRKLASILTTLANEKQRAAKDAAKGKKKTKKTTATIKQVDAIDTTDYSRNLDDDFDDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.11
4 0.11
5 0.09
6 0.11
7 0.11
8 0.12
9 0.13
10 0.14
11 0.18
12 0.21
13 0.22
14 0.24
15 0.26
16 0.24
17 0.23
18 0.23
19 0.18
20 0.14
21 0.14
22 0.11
23 0.09
24 0.1
25 0.11
26 0.11
27 0.11
28 0.16
29 0.16
30 0.16
31 0.15
32 0.15
33 0.15
34 0.16
35 0.15
36 0.11
37 0.1
38 0.1
39 0.11
40 0.11
41 0.09
42 0.14
43 0.18
44 0.23
45 0.31
46 0.34
47 0.38
48 0.4
49 0.41
50 0.41
51 0.44
52 0.45
53 0.45
54 0.54
55 0.55
56 0.61
57 0.65
58 0.67
59 0.61
60 0.59
61 0.56
62 0.55
63 0.59
64 0.6
65 0.64
66 0.59
67 0.61
68 0.6
69 0.56
70 0.54
71 0.52
72 0.5
73 0.48
74 0.45
75 0.42
76 0.41
77 0.39
78 0.32
79 0.23
80 0.17
81 0.09
82 0.09
83 0.08
84 0.07
85 0.08
86 0.08
87 0.07
88 0.07
89 0.08
90 0.09
91 0.09
92 0.1
93 0.1
94 0.12
95 0.13
96 0.11
97 0.11
98 0.1
99 0.1
100 0.09
101 0.07
102 0.05
103 0.04
104 0.04
105 0.03
106 0.03
107 0.02
108 0.03
109 0.03
110 0.03
111 0.04
112 0.04
113 0.05
114 0.07
115 0.07
116 0.08
117 0.1
118 0.12
119 0.12
120 0.12
121 0.15
122 0.18
123 0.24
124 0.27
125 0.3
126 0.36
127 0.42
128 0.47
129 0.47
130 0.46
131 0.43
132 0.41
133 0.38
134 0.34
135 0.27
136 0.22
137 0.2
138 0.16
139 0.13
140 0.11
141 0.08
142 0.06
143 0.08
144 0.1
145 0.1
146 0.14
147 0.2
148 0.23
149 0.27
150 0.29
151 0.29
152 0.3
153 0.33
154 0.31
155 0.27
156 0.24
157 0.2
158 0.18
159 0.17
160 0.14
161 0.11
162 0.09
163 0.07
164 0.07
165 0.06
166 0.07
167 0.08
168 0.08
169 0.09
170 0.09
171 0.11
172 0.14
173 0.15
174 0.2
175 0.24
176 0.24
177 0.23
178 0.24
179 0.22
180 0.19
181 0.19
182 0.15
183 0.1
184 0.11
185 0.12
186 0.16
187 0.21
188 0.21
189 0.22
190 0.27
191 0.27
192 0.3
193 0.33
194 0.33
195 0.37
196 0.46
197 0.53
198 0.57
199 0.62
200 0.68
201 0.72
202 0.77
203 0.8
204 0.81
205 0.82
206 0.81
207 0.86
208 0.86
209 0.88
210 0.84
211 0.75
212 0.7
213 0.61
214 0.53
215 0.43
216 0.35
217 0.26
218 0.21
219 0.21
220 0.2
221 0.19
222 0.2
223 0.19
224 0.19
225 0.17
226 0.18
227 0.17