Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YJE8

Protein Details
Accession A0A1Y1YJE8   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-46QCVPTRRPGASRHRRRKNPYPRRSIVPPHydrophilic
NLS Segment(s)
PositionSequence
24-41RRPGASRHRRRKNPYPRR
Subcellular Location(s) nucl 16.5, mito_nucl 12.666, cyto_nucl 9.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007526  SWIRM  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF04433  SWIRM  
PROSITE View protein in PROSITE  
PS50934  SWIRM  
Amino Acid Sequences MLLSHQTSIPSENRLATHQCVPTRRPGASRHRRRKNPYPRRSIVPPLSEEERMKLGIIKLNAVDSMYREDPQKLFELGDIQGKKSEPEIQSPHKHPHNTHKLNSDKLKKILDATLEDDIVTPPIDKRVASRSKVVWKGVPLDISRHPLYSTLLPEEADVASILRLKPDQYLTIKRVILHESRLKAQFRKTDAQRMCRVDVNKTGKVWDWFHDIGWLGNAHDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.31
4 0.35
5 0.37
6 0.4
7 0.43
8 0.44
9 0.5
10 0.5
11 0.49
12 0.47
13 0.5
14 0.56
15 0.62
16 0.71
17 0.72
18 0.78
19 0.85
20 0.9
21 0.92
22 0.92
23 0.92
24 0.91
25 0.91
26 0.85
27 0.82
28 0.79
29 0.78
30 0.73
31 0.67
32 0.59
33 0.53
34 0.52
35 0.48
36 0.43
37 0.35
38 0.29
39 0.25
40 0.22
41 0.2
42 0.18
43 0.18
44 0.18
45 0.17
46 0.16
47 0.16
48 0.16
49 0.14
50 0.12
51 0.09
52 0.14
53 0.14
54 0.14
55 0.15
56 0.18
57 0.18
58 0.19
59 0.2
60 0.16
61 0.15
62 0.14
63 0.15
64 0.14
65 0.2
66 0.18
67 0.16
68 0.18
69 0.18
70 0.18
71 0.17
72 0.23
73 0.17
74 0.23
75 0.28
76 0.33
77 0.4
78 0.43
79 0.48
80 0.47
81 0.49
82 0.46
83 0.51
84 0.55
85 0.55
86 0.55
87 0.56
88 0.54
89 0.57
90 0.62
91 0.58
92 0.51
93 0.49
94 0.47
95 0.39
96 0.36
97 0.32
98 0.26
99 0.2
100 0.18
101 0.16
102 0.14
103 0.14
104 0.12
105 0.11
106 0.09
107 0.08
108 0.06
109 0.05
110 0.07
111 0.08
112 0.07
113 0.09
114 0.18
115 0.24
116 0.26
117 0.29
118 0.32
119 0.4
120 0.44
121 0.44
122 0.37
123 0.33
124 0.35
125 0.32
126 0.31
127 0.24
128 0.23
129 0.24
130 0.27
131 0.26
132 0.23
133 0.21
134 0.19
135 0.2
136 0.2
137 0.19
138 0.16
139 0.16
140 0.15
141 0.15
142 0.15
143 0.13
144 0.1
145 0.08
146 0.06
147 0.06
148 0.08
149 0.08
150 0.08
151 0.09
152 0.09
153 0.12
154 0.14
155 0.19
156 0.23
157 0.3
158 0.31
159 0.37
160 0.38
161 0.36
162 0.37
163 0.36
164 0.33
165 0.33
166 0.37
167 0.34
168 0.38
169 0.43
170 0.45
171 0.45
172 0.49
173 0.49
174 0.49
175 0.55
176 0.55
177 0.59
178 0.62
179 0.66
180 0.68
181 0.66
182 0.63
183 0.59
184 0.56
185 0.52
186 0.54
187 0.54
188 0.5
189 0.45
190 0.45
191 0.43
192 0.47
193 0.44
194 0.37
195 0.37
196 0.34
197 0.33
198 0.34
199 0.29
200 0.24
201 0.24
202 0.21