Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1X725

Protein Details
Accession A0A1Y1X725    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-35KDAPAKPSSGGKKTKKKWSKGKVKDKANNLVVHydrophilic
NLS Segment(s)
PositionSequence
4-28KDAPAKPSSGGKKTKKKWSKGKVKD
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKDAPAKPSSGGKKTKKKWSKGKVKDKANNLVVFDQATLDKLMKEAPTYKLITTSVLVDRLRINGSLARVALRELETQGLIQKVSTHGSQLIYTRSISAGGEEAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.75
4 0.81
5 0.81
6 0.84
7 0.86
8 0.87
9 0.89
10 0.89
11 0.92
12 0.9
13 0.91
14 0.88
15 0.85
16 0.83
17 0.78
18 0.69
19 0.6
20 0.51
21 0.41
22 0.34
23 0.26
24 0.18
25 0.11
26 0.1
27 0.08
28 0.08
29 0.07
30 0.07
31 0.08
32 0.08
33 0.09
34 0.11
35 0.13
36 0.16
37 0.18
38 0.17
39 0.17
40 0.17
41 0.17
42 0.15
43 0.14
44 0.11
45 0.14
46 0.13
47 0.13
48 0.13
49 0.14
50 0.14
51 0.12
52 0.13
53 0.11
54 0.12
55 0.13
56 0.12
57 0.12
58 0.11
59 0.11
60 0.12
61 0.11
62 0.11
63 0.11
64 0.12
65 0.11
66 0.11
67 0.13
68 0.12
69 0.11
70 0.1
71 0.1
72 0.11
73 0.14
74 0.14
75 0.13
76 0.14
77 0.16
78 0.18
79 0.19
80 0.2
81 0.19
82 0.19
83 0.18
84 0.17
85 0.16
86 0.14
87 0.13