Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XG98

Protein Details
Accession A0A1Y1XG98    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-42VVVPRRERRRPTPLPRRSSTHydrophilic
NLS Segment(s)
PositionSequence
30-32RRR
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MAVLSPTITSKRSLPCTWFSVFVVVPRRERRRPTPLPRRSSTSTRSTTRSTRTARSPVSDVNVLPPSAVLVCSWHGIMTVNTAVNAASPTSSRRKVKTNRFHHLLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.44
4 0.43
5 0.41
6 0.34
7 0.3
8 0.28
9 0.28
10 0.32
11 0.3
12 0.36
13 0.42
14 0.49
15 0.53
16 0.6
17 0.63
18 0.65
19 0.72
20 0.76
21 0.78
22 0.8
23 0.81
24 0.77
25 0.76
26 0.71
27 0.67
28 0.61
29 0.57
30 0.54
31 0.49
32 0.49
33 0.46
34 0.45
35 0.44
36 0.46
37 0.42
38 0.4
39 0.42
40 0.44
41 0.41
42 0.39
43 0.37
44 0.3
45 0.3
46 0.27
47 0.22
48 0.2
49 0.2
50 0.17
51 0.14
52 0.13
53 0.1
54 0.09
55 0.09
56 0.05
57 0.06
58 0.07
59 0.08
60 0.08
61 0.07
62 0.07
63 0.08
64 0.08
65 0.1
66 0.11
67 0.1
68 0.1
69 0.1
70 0.1
71 0.09
72 0.1
73 0.07
74 0.06
75 0.07
76 0.12
77 0.19
78 0.28
79 0.33
80 0.37
81 0.47
82 0.56
83 0.67
84 0.73
85 0.75
86 0.78
87 0.79