Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YUV4

Protein Details
Accession A0A1Y1YUV4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-31KSTKSSTSSKSKSRGKDKEKDEKKLLHydrophilic
NLS Segment(s)
PositionSequence
9-34KSSTSSKSKSRGKDKEKDEKKLLSPK
Subcellular Location(s) nucl 22.5, mito_nucl 14, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024145  His_deAcase_SAP30/SAP30L  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MAAKPKSTKSSTSSKSKSRGKDKEKDEKKLLSPKKSDQTLQGEALPKLNFDTLNMNVLRKYRRVFKVNVKSRSNRPELVAAVSKHFASQTVNEHETISLFLYSVHNKDKILKLPPSAIPSEQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.71
4 0.76
5 0.77
6 0.8
7 0.79
8 0.81
9 0.82
10 0.84
11 0.84
12 0.83
13 0.78
14 0.74
15 0.72
16 0.73
17 0.71
18 0.69
19 0.66
20 0.65
21 0.66
22 0.64
23 0.59
24 0.55
25 0.54
26 0.49
27 0.45
28 0.4
29 0.35
30 0.32
31 0.34
32 0.26
33 0.19
34 0.17
35 0.16
36 0.13
37 0.11
38 0.14
39 0.11
40 0.15
41 0.16
42 0.15
43 0.15
44 0.18
45 0.19
46 0.18
47 0.2
48 0.24
49 0.3
50 0.33
51 0.37
52 0.45
53 0.54
54 0.61
55 0.67
56 0.64
57 0.63
58 0.66
59 0.69
60 0.63
61 0.53
62 0.46
63 0.41
64 0.37
65 0.36
66 0.34
67 0.27
68 0.24
69 0.23
70 0.21
71 0.18
72 0.17
73 0.14
74 0.11
75 0.13
76 0.18
77 0.23
78 0.24
79 0.25
80 0.25
81 0.25
82 0.23
83 0.21
84 0.16
85 0.09
86 0.08
87 0.08
88 0.11
89 0.14
90 0.17
91 0.21
92 0.21
93 0.22
94 0.28
95 0.33
96 0.37
97 0.42
98 0.43
99 0.42
100 0.46
101 0.5
102 0.49
103 0.46