Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YL65

Protein Details
Accession A0A1Y1YL65    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-71TCSVCGKKYKHKNCLYKHFWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito_nucl 10.999, cyto_nucl 10.833, mito 8.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MTISSEFHPQPSFLFSKNDKFKVNLKAARENLQNKSELRLQNNSTNFRTIHTCSVCGKKYKHKNCLYKHFWEHHESWETCLKFNLTKHQQVQMMEAAQILVDMVALPTPQQPRRFSADAEAEAFVSCEVPNVQRRQSVPAKWLSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.39
4 0.47
5 0.51
6 0.47
7 0.48
8 0.53
9 0.55
10 0.6
11 0.55
12 0.52
13 0.57
14 0.57
15 0.6
16 0.61
17 0.58
18 0.54
19 0.51
20 0.49
21 0.41
22 0.42
23 0.42
24 0.39
25 0.37
26 0.38
27 0.38
28 0.42
29 0.47
30 0.48
31 0.43
32 0.41
33 0.37
34 0.33
35 0.33
36 0.29
37 0.31
38 0.27
39 0.27
40 0.28
41 0.34
42 0.35
43 0.37
44 0.38
45 0.4
46 0.5
47 0.57
48 0.64
49 0.67
50 0.73
51 0.75
52 0.82
53 0.77
54 0.74
55 0.7
56 0.65
57 0.59
58 0.54
59 0.48
60 0.41
61 0.42
62 0.35
63 0.32
64 0.33
65 0.3
66 0.26
67 0.25
68 0.22
69 0.19
70 0.2
71 0.27
72 0.27
73 0.33
74 0.35
75 0.39
76 0.41
77 0.38
78 0.39
79 0.32
80 0.27
81 0.2
82 0.18
83 0.13
84 0.09
85 0.08
86 0.06
87 0.03
88 0.02
89 0.02
90 0.02
91 0.03
92 0.03
93 0.04
94 0.08
95 0.14
96 0.2
97 0.26
98 0.29
99 0.33
100 0.4
101 0.42
102 0.39
103 0.4
104 0.41
105 0.37
106 0.37
107 0.33
108 0.26
109 0.23
110 0.22
111 0.15
112 0.1
113 0.08
114 0.07
115 0.08
116 0.13
117 0.21
118 0.26
119 0.29
120 0.34
121 0.36
122 0.42
123 0.49
124 0.49
125 0.48