Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XP69

Protein Details
Accession A0A1Y1XP69    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-94LNYFFRSARRRKPVEKAPPPAPKVHydrophilic
NLS Segment(s)
PositionSequence
79-88RRRKPVEKAP
Subcellular Location(s) extr 12, plas 8, mito 2, cyto 2, vacu 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MQLRKGFFLLSIMSLTWTQPGAAGVALSRRDIVESRYALDPDAIDEALGLGFVSGIFTGIPIIEHIVDGALNYFFRSARRRKPVEKAPPPAPKVEQTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.11
5 0.09
6 0.09
7 0.09
8 0.08
9 0.07
10 0.07
11 0.06
12 0.09
13 0.1
14 0.1
15 0.1
16 0.09
17 0.11
18 0.12
19 0.14
20 0.16
21 0.16
22 0.18
23 0.19
24 0.19
25 0.18
26 0.17
27 0.15
28 0.1
29 0.1
30 0.08
31 0.06
32 0.05
33 0.05
34 0.05
35 0.04
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.07
62 0.11
63 0.19
64 0.26
65 0.36
66 0.46
67 0.54
68 0.6
69 0.7
70 0.77
71 0.81
72 0.82
73 0.8
74 0.8
75 0.82
76 0.78
77 0.73
78 0.67