Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YQ75

Protein Details
Accession A0A1Y1YQ75    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-31SLPVKKPKTSRACDACRRKKVKCHydrophilic
48-68CTFSYKPKKRGPSPSLQKILEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSHLLGTPSLPVKKPKTSRACDACRRKKVKCDGALPACSHCATSGLDCTFSYKPKKRGPSPSLQKILEGRVERLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.62
4 0.64
5 0.71
6 0.73
7 0.76
8 0.76
9 0.81
10 0.81
11 0.81
12 0.82
13 0.76
14 0.76
15 0.77
16 0.76
17 0.71
18 0.66
19 0.64
20 0.63
21 0.62
22 0.53
23 0.44
24 0.36
25 0.29
26 0.24
27 0.15
28 0.12
29 0.09
30 0.09
31 0.12
32 0.11
33 0.12
34 0.12
35 0.16
36 0.17
37 0.21
38 0.3
39 0.34
40 0.42
41 0.5
42 0.59
43 0.64
44 0.73
45 0.75
46 0.77
47 0.79
48 0.81
49 0.8
50 0.71
51 0.67
52 0.59
53 0.56
54 0.52
55 0.45