Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8P531

Protein Details
Accession B8P531    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
150-169NDDRNKKRDDGKKGDKDVEKBasic
NLS Segment(s)
PositionSequence
122-133KTPKKVAKLVKR
154-180NKKRDDGKKGDKDVEKRGKNVKKETRR
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
KEGG ppl:POSPLDRAFT_96663  -  
Amino Acid Sequences MLRHCHLIDLPSTSSAATDGFEEIRTAARVRSDGSVSVREEYHFRRVHSDGRVDEETRTYRVETRRADASLEKRAQFTNLTGANKGEDSKVRKVGAVKVDEAKRDDQVKKPIRVKVNHDSMKTPKKVAKLVKRDAVKKDVRFTNDEGVSNDDRNKKRDDGKKGDKDVEKRGKNVKKETRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.13
4 0.09
5 0.08
6 0.09
7 0.09
8 0.1
9 0.1
10 0.1
11 0.11
12 0.12
13 0.12
14 0.12
15 0.14
16 0.14
17 0.16
18 0.18
19 0.18
20 0.2
21 0.22
22 0.25
23 0.25
24 0.26
25 0.24
26 0.22
27 0.25
28 0.25
29 0.31
30 0.3
31 0.29
32 0.33
33 0.35
34 0.4
35 0.4
36 0.42
37 0.34
38 0.38
39 0.4
40 0.35
41 0.33
42 0.31
43 0.28
44 0.24
45 0.24
46 0.19
47 0.22
48 0.25
49 0.32
50 0.3
51 0.31
52 0.33
53 0.32
54 0.33
55 0.33
56 0.33
57 0.34
58 0.35
59 0.33
60 0.3
61 0.3
62 0.29
63 0.25
64 0.21
65 0.19
66 0.19
67 0.19
68 0.19
69 0.19
70 0.18
71 0.17
72 0.17
73 0.13
74 0.13
75 0.17
76 0.2
77 0.23
78 0.23
79 0.24
80 0.25
81 0.29
82 0.3
83 0.27
84 0.25
85 0.27
86 0.29
87 0.29
88 0.3
89 0.26
90 0.23
91 0.28
92 0.29
93 0.29
94 0.37
95 0.43
96 0.49
97 0.53
98 0.57
99 0.58
100 0.6
101 0.62
102 0.61
103 0.63
104 0.61
105 0.57
106 0.55
107 0.55
108 0.59
109 0.54
110 0.49
111 0.42
112 0.42
113 0.47
114 0.53
115 0.55
116 0.55
117 0.61
118 0.64
119 0.67
120 0.69
121 0.67
122 0.66
123 0.64
124 0.59
125 0.6
126 0.58
127 0.56
128 0.53
129 0.52
130 0.51
131 0.46
132 0.43
133 0.36
134 0.36
135 0.35
136 0.33
137 0.36
138 0.37
139 0.37
140 0.39
141 0.43
142 0.44
143 0.51
144 0.57
145 0.62
146 0.64
147 0.71
148 0.77
149 0.79
150 0.81
151 0.8
152 0.77
153 0.77
154 0.77
155 0.71
156 0.68
157 0.72
158 0.71
159 0.73
160 0.78