Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YHC2

Protein Details
Accession A0A1Y1YHC2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-29AKTKSTKSSTKSRSRGKDKDKEEKKLVBasic
NLS Segment(s)
PositionSequence
9-32KSSTKSRSRGKDKDKEEKKLVSPR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024145  His_deAcase_SAP30/SAP30L  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MAAKTKSTKSSTKSRSRGKDKDKEEKKLVSPRKNESGLEAEAQPKLDFEGFNMNILRKYRRVFKVNVKSRSNRAELVAAVSKHFASQTLNEHEAISLFLYSVHNRDKILKLPPSAVSTEQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.83
4 0.88
5 0.87
6 0.87
7 0.85
8 0.87
9 0.85
10 0.83
11 0.79
12 0.75
13 0.72
14 0.73
15 0.74
16 0.71
17 0.69
18 0.67
19 0.68
20 0.65
21 0.58
22 0.51
23 0.46
24 0.38
25 0.34
26 0.28
27 0.22
28 0.2
29 0.2
30 0.16
31 0.11
32 0.11
33 0.1
34 0.09
35 0.08
36 0.16
37 0.15
38 0.17
39 0.18
40 0.17
41 0.19
42 0.21
43 0.22
44 0.17
45 0.19
46 0.26
47 0.31
48 0.35
49 0.37
50 0.46
51 0.54
52 0.61
53 0.67
54 0.64
55 0.61
56 0.63
57 0.63
58 0.56
59 0.46
60 0.38
61 0.31
62 0.26
63 0.27
64 0.25
65 0.2
66 0.17
67 0.17
68 0.15
69 0.14
70 0.13
71 0.1
72 0.08
73 0.11
74 0.17
75 0.22
76 0.24
77 0.24
78 0.24
79 0.23
80 0.22
81 0.19
82 0.13
83 0.08
84 0.06
85 0.07
86 0.09
87 0.1
88 0.14
89 0.18
90 0.19
91 0.2
92 0.25
93 0.28
94 0.31
95 0.39
96 0.41
97 0.39
98 0.41
99 0.44
100 0.42
101 0.42