Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WQA6

Protein Details
Accession A0A1Y1WQA6    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-43VKCGYLLKRSTKRKVWKKRWFVLRGTHydrophilic
NLS Segment(s)
PositionSequence
29-35KRKVWKK
Subcellular Location(s) cyto_nucl 12.333, cyto 12, nucl 9.5, cyto_pero 6.999, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR001849  PH_domain  
Pfam View protein in Pfam  
PF00169  PH  
PROSITE View protein in PROSITE  
PS50003  PH_DOMAIN  
Amino Acid Sequences MTHEGFRAVEELNNQALVKCGYLLKRSTKRKVWKKRWFVLRGTSLTCYKDDKEYELERIIDLSEAIQILEATWKTRKNVFGIVVSKKKYYFQAEVTYSIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.15
4 0.14
5 0.12
6 0.11
7 0.13
8 0.14
9 0.18
10 0.23
11 0.31
12 0.4
13 0.48
14 0.56
15 0.62
16 0.7
17 0.77
18 0.84
19 0.85
20 0.86
21 0.87
22 0.88
23 0.89
24 0.83
25 0.76
26 0.73
27 0.67
28 0.59
29 0.51
30 0.45
31 0.37
32 0.33
33 0.3
34 0.25
35 0.19
36 0.21
37 0.19
38 0.18
39 0.21
40 0.22
41 0.23
42 0.22
43 0.22
44 0.18
45 0.17
46 0.15
47 0.1
48 0.08
49 0.06
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.07
57 0.07
58 0.09
59 0.13
60 0.16
61 0.18
62 0.23
63 0.26
64 0.27
65 0.32
66 0.33
67 0.36
68 0.39
69 0.46
70 0.48
71 0.48
72 0.47
73 0.43
74 0.43
75 0.43
76 0.44
77 0.41
78 0.39
79 0.45
80 0.45