Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y1C3

Protein Details
Accession A0A1Y1Y1C3   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-115VEDTPKKKPRKTPTKKRTKKADPEEKEKKPBasic
NLS Segment(s)
PositionSequence
90-117PKKKPRKTPTKKRTKKADPEEKEKKPRA
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014876  DEK_C  
IPR019835  SWIB_domain  
IPR036885  SWIB_MDM2_dom_sf  
IPR003121  SWIB_MDM2_domain  
Pfam View protein in Pfam  
PF08766  DEK_C  
PF02201  SWIB  
PROSITE View protein in PROSITE  
PS51998  DEK_C  
PS51925  SWIB_MDM2  
CDD cd10567  SWIB-MDM2_like  
Amino Acid Sequences MAEFEAEIKEILAQSDINTVSAKKVRTALEERHGISLKERKQEIDKLILKCFDALQEEDVEEEELSTGTPKKRVKKSSGDESLSEVEDTPKKKPRKTPTKKRTKKADPEEKEKKPRAANPNSGFNKPYLLSPLLAEIVGAEELPRPEVTKRIWQYIKERDLQDPQDKRYIACDEKLKEVFETDRVHMFTMNKLLSQHLKDKPVEATAETAAEATVDATPKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.14
4 0.14
5 0.14
6 0.14
7 0.19
8 0.23
9 0.23
10 0.21
11 0.26
12 0.28
13 0.34
14 0.4
15 0.42
16 0.45
17 0.5
18 0.48
19 0.49
20 0.48
21 0.41
22 0.41
23 0.43
24 0.41
25 0.43
26 0.43
27 0.4
28 0.44
29 0.51
30 0.48
31 0.5
32 0.51
33 0.46
34 0.49
35 0.46
36 0.41
37 0.35
38 0.31
39 0.23
40 0.19
41 0.17
42 0.15
43 0.14
44 0.14
45 0.13
46 0.13
47 0.12
48 0.09
49 0.08
50 0.06
51 0.05
52 0.05
53 0.07
54 0.1
55 0.1
56 0.18
57 0.23
58 0.32
59 0.41
60 0.48
61 0.54
62 0.6
63 0.66
64 0.7
65 0.73
66 0.66
67 0.58
68 0.54
69 0.49
70 0.39
71 0.31
72 0.21
73 0.16
74 0.17
75 0.18
76 0.19
77 0.26
78 0.31
79 0.36
80 0.45
81 0.53
82 0.61
83 0.71
84 0.78
85 0.8
86 0.86
87 0.91
88 0.91
89 0.9
90 0.89
91 0.88
92 0.87
93 0.88
94 0.82
95 0.83
96 0.83
97 0.79
98 0.78
99 0.71
100 0.66
101 0.59
102 0.61
103 0.61
104 0.59
105 0.61
106 0.56
107 0.62
108 0.6
109 0.57
110 0.5
111 0.4
112 0.35
113 0.26
114 0.23
115 0.16
116 0.14
117 0.13
118 0.13
119 0.13
120 0.11
121 0.11
122 0.1
123 0.06
124 0.06
125 0.05
126 0.05
127 0.04
128 0.05
129 0.05
130 0.07
131 0.07
132 0.08
133 0.08
134 0.13
135 0.16
136 0.24
137 0.26
138 0.34
139 0.37
140 0.4
141 0.48
142 0.53
143 0.56
144 0.52
145 0.52
146 0.47
147 0.5
148 0.52
149 0.54
150 0.49
151 0.47
152 0.48
153 0.46
154 0.42
155 0.41
156 0.42
157 0.35
158 0.35
159 0.39
160 0.34
161 0.41
162 0.43
163 0.39
164 0.32
165 0.32
166 0.29
167 0.27
168 0.29
169 0.24
170 0.27
171 0.27
172 0.27
173 0.27
174 0.26
175 0.24
176 0.27
177 0.26
178 0.23
179 0.22
180 0.26
181 0.29
182 0.33
183 0.38
184 0.37
185 0.42
186 0.42
187 0.44
188 0.43
189 0.4
190 0.38
191 0.3
192 0.27
193 0.22
194 0.22
195 0.19
196 0.16
197 0.12
198 0.1
199 0.09
200 0.07
201 0.08