Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1Y2K4

Protein Details
Accession A0A1Y1Y2K4    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-61ELTQTQKKRRLKKELGECLEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 12.333, nucl 11, mito_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR022617  Rad60/SUMO-like_dom  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF11976  Rad60-SLD  
Amino Acid Sequences MTTPDKIVLTFNEVRVFPHATPQSLGLSDKVKLAAYSKEHFELTQTQKKRRLKKELGECLEEQIPALTIRLKHKDKDVEHLRVKKTTKLKRIVETYRHQKTIDSTVPIELCFDGVKLNPELTLEETEIEDGDLVFVAFENPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.32
4 0.25
5 0.3
6 0.31
7 0.28
8 0.29
9 0.29
10 0.27
11 0.24
12 0.25
13 0.18
14 0.18
15 0.17
16 0.17
17 0.16
18 0.15
19 0.14
20 0.15
21 0.18
22 0.21
23 0.22
24 0.24
25 0.25
26 0.25
27 0.24
28 0.24
29 0.28
30 0.31
31 0.37
32 0.4
33 0.44
34 0.53
35 0.61
36 0.68
37 0.69
38 0.72
39 0.72
40 0.76
41 0.8
42 0.81
43 0.77
44 0.71
45 0.61
46 0.53
47 0.45
48 0.36
49 0.25
50 0.15
51 0.12
52 0.08
53 0.08
54 0.07
55 0.09
56 0.13
57 0.21
58 0.23
59 0.23
60 0.28
61 0.36
62 0.35
63 0.43
64 0.46
65 0.46
66 0.51
67 0.57
68 0.54
69 0.52
70 0.53
71 0.49
72 0.52
73 0.52
74 0.55
75 0.58
76 0.6
77 0.61
78 0.68
79 0.68
80 0.66
81 0.67
82 0.68
83 0.65
84 0.62
85 0.56
86 0.49
87 0.45
88 0.46
89 0.41
90 0.34
91 0.28
92 0.29
93 0.29
94 0.28
95 0.25
96 0.17
97 0.14
98 0.1
99 0.09
100 0.08
101 0.08
102 0.12
103 0.12
104 0.12
105 0.11
106 0.12
107 0.14
108 0.15
109 0.17
110 0.14
111 0.14
112 0.14
113 0.14
114 0.13
115 0.12
116 0.09
117 0.06
118 0.06
119 0.05
120 0.05
121 0.04
122 0.04