Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XMW2

Protein Details
Accession A0A1Y1XMW2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-70VMACMKNSPNKPKKPNTINYHLARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 11, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MKLKYLKVKPRKVIAESPCVAEVTMLLNCWSSFTPDNPKCAESAKAVMACMKNSPNKPKKPNTINYHLARLGKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.68
3 0.6
4 0.55
5 0.46
6 0.39
7 0.33
8 0.23
9 0.18
10 0.11
11 0.1
12 0.08
13 0.07
14 0.08
15 0.08
16 0.09
17 0.09
18 0.1
19 0.11
20 0.13
21 0.23
22 0.24
23 0.27
24 0.27
25 0.28
26 0.25
27 0.25
28 0.25
29 0.16
30 0.17
31 0.17
32 0.16
33 0.16
34 0.19
35 0.18
36 0.17
37 0.18
38 0.2
39 0.24
40 0.3
41 0.41
42 0.47
43 0.56
44 0.64
45 0.71
46 0.77
47 0.8
48 0.84
49 0.82
50 0.81
51 0.81
52 0.75
53 0.73
54 0.66
55 0.58