Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XXA5

Protein Details
Accession A0A1Y1XXA5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-93VTRGKGFTKEKNKKKRGSYRGGKIDLEBasic
NLS Segment(s)
PositionSequence
71-86KGFTKEKNKKKRGSYR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MSVATPNKRPAESDETPKSKRTPNTPFCRIKDEDVVFHDERLMDNTFMSKGGSLGSYGHKAHNDLIVTRGKGFTKEKNKKKRGSYRGGKIDLESHSIKFNFDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.57
4 0.59
5 0.56
6 0.54
7 0.55
8 0.55
9 0.57
10 0.6
11 0.67
12 0.72
13 0.77
14 0.72
15 0.73
16 0.66
17 0.59
18 0.57
19 0.5
20 0.43
21 0.37
22 0.41
23 0.34
24 0.31
25 0.28
26 0.19
27 0.18
28 0.18
29 0.17
30 0.1
31 0.1
32 0.1
33 0.1
34 0.1
35 0.1
36 0.07
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.08
43 0.11
44 0.11
45 0.13
46 0.13
47 0.14
48 0.15
49 0.17
50 0.16
51 0.13
52 0.16
53 0.18
54 0.18
55 0.18
56 0.19
57 0.16
58 0.2
59 0.24
60 0.3
61 0.38
62 0.48
63 0.57
64 0.66
65 0.75
66 0.79
67 0.86
68 0.88
69 0.86
70 0.87
71 0.87
72 0.86
73 0.87
74 0.83
75 0.73
76 0.64
77 0.59
78 0.5
79 0.46
80 0.37
81 0.29
82 0.3
83 0.29