Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Z874

Protein Details
Accession A0A1Y1Z874    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-72RSLGPPRKQRDQQKPRIEPPBasic
NLS Segment(s)
PositionSequence
58-59PR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041260  Sld7_C  
Pfam View protein in Pfam  
PF18596  Sld7_C  
Amino Acid Sequences MIPSLSSEDFTVSSPGKPILPEEDYIKRIGHDKPNTAVKLPAIMKMNNLRRHRSLGPPRKQRDQQKPRIEPPVFYEVDNKKELKRIAVNALQKIGILRGHPDFTAYWSQLYKSCQFALRKDIKTRHITNEEMQNTVEEHVEFYRRQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.17
5 0.18
6 0.2
7 0.21
8 0.22
9 0.25
10 0.3
11 0.3
12 0.31
13 0.29
14 0.24
15 0.26
16 0.3
17 0.35
18 0.34
19 0.37
20 0.41
21 0.49
22 0.49
23 0.47
24 0.42
25 0.33
26 0.34
27 0.31
28 0.29
29 0.25
30 0.23
31 0.26
32 0.33
33 0.41
34 0.43
35 0.46
36 0.46
37 0.46
38 0.51
39 0.51
40 0.52
41 0.55
42 0.57
43 0.63
44 0.69
45 0.71
46 0.74
47 0.78
48 0.78
49 0.78
50 0.78
51 0.78
52 0.79
53 0.8
54 0.76
55 0.78
56 0.69
57 0.58
58 0.52
59 0.48
60 0.38
61 0.32
62 0.35
63 0.27
64 0.3
65 0.32
66 0.28
67 0.22
68 0.26
69 0.27
70 0.24
71 0.25
72 0.24
73 0.27
74 0.32
75 0.35
76 0.32
77 0.32
78 0.28
79 0.24
80 0.22
81 0.17
82 0.13
83 0.09
84 0.11
85 0.12
86 0.13
87 0.13
88 0.14
89 0.13
90 0.15
91 0.2
92 0.18
93 0.18
94 0.17
95 0.19
96 0.2
97 0.24
98 0.23
99 0.22
100 0.23
101 0.28
102 0.31
103 0.33
104 0.39
105 0.44
106 0.48
107 0.53
108 0.58
109 0.59
110 0.65
111 0.67
112 0.66
113 0.62
114 0.6
115 0.56
116 0.59
117 0.53
118 0.46
119 0.41
120 0.33
121 0.29
122 0.26
123 0.23
124 0.13
125 0.13
126 0.14
127 0.18