Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YIK2

Protein Details
Accession A0A1Y1YIK2   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
232-259RGGRRDSRDRSRYRDRDRDSRRYDRSREBasic
295-318ADNSRRRSRSRDYEDRDRKRHREMBasic
NLS Segment(s)
PositionSequence
226-253GEKPRDRGGRRDSRDRSRYRDRDRDSRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR004882  Luc7-rel  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0003729  F:mRNA binding  
GO:0006376  P:mRNA splice site selection  
Pfam View protein in Pfam  
PF03194  LUC7  
Amino Acid Sequences MDYARNLLSELMSPYESESKKKFYDRDVCKYFLVRFCPHELFINTKSDLGPCDKIHEEALRRDYQEAEDRDKYGYEEEFYEYLQSLINDLDRKIRKGKERLNIQPDESLLNPNKDEKEEKIVLLDERIKSLLAQIEEAGEEGRVQEAQDLNQQLERLQAELATLKNNDDSNPIFKQEKRMEVCDVCGSFLVTNDTSKRLDAHMEGKQHTGYAKIREALDEYIKKYGEKPRDRGGRRDSRDRSRYRDRDRDSRRYDRSREGDRYSDRDYRRRDRDSYERRRSGDRDYHRDYEDRDADNSRRRSRSRDYEDRDRKRHREM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.25
3 0.26
4 0.3
5 0.32
6 0.36
7 0.41
8 0.48
9 0.49
10 0.51
11 0.6
12 0.63
13 0.69
14 0.68
15 0.66
16 0.61
17 0.61
18 0.57
19 0.52
20 0.5
21 0.44
22 0.42
23 0.46
24 0.46
25 0.43
26 0.44
27 0.4
28 0.39
29 0.38
30 0.39
31 0.33
32 0.31
33 0.3
34 0.25
35 0.26
36 0.25
37 0.27
38 0.22
39 0.27
40 0.27
41 0.28
42 0.3
43 0.33
44 0.33
45 0.34
46 0.4
47 0.38
48 0.38
49 0.38
50 0.36
51 0.33
52 0.38
53 0.35
54 0.36
55 0.34
56 0.34
57 0.34
58 0.33
59 0.3
60 0.24
61 0.21
62 0.15
63 0.14
64 0.16
65 0.16
66 0.15
67 0.15
68 0.13
69 0.12
70 0.11
71 0.1
72 0.08
73 0.08
74 0.1
75 0.11
76 0.11
77 0.2
78 0.21
79 0.25
80 0.31
81 0.36
82 0.43
83 0.51
84 0.59
85 0.59
86 0.66
87 0.72
88 0.73
89 0.69
90 0.62
91 0.54
92 0.47
93 0.4
94 0.31
95 0.28
96 0.22
97 0.21
98 0.2
99 0.22
100 0.22
101 0.23
102 0.24
103 0.2
104 0.26
105 0.25
106 0.25
107 0.23
108 0.23
109 0.21
110 0.21
111 0.23
112 0.16
113 0.16
114 0.16
115 0.14
116 0.13
117 0.14
118 0.14
119 0.1
120 0.1
121 0.09
122 0.09
123 0.09
124 0.1
125 0.08
126 0.05
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.06
133 0.06
134 0.07
135 0.11
136 0.12
137 0.12
138 0.13
139 0.13
140 0.11
141 0.12
142 0.12
143 0.08
144 0.08
145 0.07
146 0.07
147 0.08
148 0.08
149 0.08
150 0.08
151 0.08
152 0.1
153 0.1
154 0.1
155 0.12
156 0.13
157 0.15
158 0.16
159 0.18
160 0.19
161 0.19
162 0.28
163 0.29
164 0.35
165 0.34
166 0.36
167 0.37
168 0.35
169 0.37
170 0.31
171 0.27
172 0.2
173 0.17
174 0.15
175 0.11
176 0.11
177 0.12
178 0.09
179 0.1
180 0.11
181 0.14
182 0.14
183 0.14
184 0.15
185 0.12
186 0.14
187 0.15
188 0.19
189 0.21
190 0.25
191 0.26
192 0.26
193 0.25
194 0.24
195 0.22
196 0.21
197 0.2
198 0.21
199 0.22
200 0.23
201 0.23
202 0.23
203 0.25
204 0.23
205 0.27
206 0.25
207 0.24
208 0.25
209 0.25
210 0.25
211 0.28
212 0.33
213 0.37
214 0.42
215 0.45
216 0.51
217 0.61
218 0.64
219 0.68
220 0.7
221 0.7
222 0.69
223 0.74
224 0.73
225 0.73
226 0.79
227 0.77
228 0.76
229 0.76
230 0.8
231 0.79
232 0.81
233 0.78
234 0.79
235 0.82
236 0.85
237 0.82
238 0.82
239 0.82
240 0.8
241 0.79
242 0.78
243 0.77
244 0.75
245 0.74
246 0.69
247 0.67
248 0.63
249 0.63
250 0.6
251 0.6
252 0.57
253 0.58
254 0.62
255 0.64
256 0.68
257 0.69
258 0.67
259 0.67
260 0.73
261 0.76
262 0.78
263 0.79
264 0.77
265 0.73
266 0.76
267 0.71
268 0.7
269 0.69
270 0.67
271 0.66
272 0.66
273 0.68
274 0.63
275 0.63
276 0.57
277 0.56
278 0.53
279 0.46
280 0.42
281 0.43
282 0.47
283 0.53
284 0.59
285 0.58
286 0.6
287 0.61
288 0.66
289 0.7
290 0.74
291 0.75
292 0.77
293 0.77
294 0.8
295 0.87
296 0.9
297 0.9
298 0.89