Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YQR8

Protein Details
Accession A0A1Y1YQR8   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-73QKSFKVKRILGKKQKQNRPIPHWIRLRTDNKIRYNAKRRHWRRTKLGLHydrophilic
NLS Segment(s)
PositionSequence
30-71KVKRILGKKQKQNRPIPHWIRLRTDNKIRYNAKRRHWRRTKL
Subcellular Location(s) mito 22.5, mito_nucl 13, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MVRRIFPIPHTSIMSPTGRGGDVPSQKSFKVKRILGKKQKQNRPIPHWIRLRTDNKIRYNAKRRHWRRTKLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.26
3 0.23
4 0.2
5 0.17
6 0.16
7 0.16
8 0.19
9 0.24
10 0.26
11 0.28
12 0.28
13 0.29
14 0.36
15 0.36
16 0.35
17 0.38
18 0.38
19 0.43
20 0.51
21 0.61
22 0.65
23 0.71
24 0.74
25 0.76
26 0.81
27 0.82
28 0.82
29 0.81
30 0.78
31 0.8
32 0.76
33 0.75
34 0.75
35 0.69
36 0.65
37 0.65
38 0.62
39 0.59
40 0.63
41 0.63
42 0.61
43 0.66
44 0.67
45 0.69
46 0.74
47 0.75
48 0.76
49 0.78
50 0.81
51 0.83
52 0.87
53 0.86