Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X651

Protein Details
Accession A0A1Y1X651    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-48CSVTCYKKHKEVPCQKPAPKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 11.333, cyto_nucl 10.333, mito 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007529  Znf_HIT  
Pfam View protein in Pfam  
PF04438  zf-HIT  
PROSITE View protein in PROSITE  
PS51083  ZF_HIT  
Amino Acid Sequences MNTPNKPLCKVCNTEPFKYKCSVCLLPYCSVTCYKKHKEVPCQKPAPKVEEPPVVEEEETENEENKLSDEQLQMLASSDKVREMLKTTYLKELIKQIDSSDKPEKILEQTRQKEPLFDEFANTLIDVLVKKKEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.65
4 0.6
5 0.6
6 0.52
7 0.46
8 0.47
9 0.44
10 0.38
11 0.41
12 0.42
13 0.39
14 0.41
15 0.38
16 0.32
17 0.34
18 0.34
19 0.33
20 0.38
21 0.42
22 0.48
23 0.56
24 0.62
25 0.66
26 0.75
27 0.78
28 0.79
29 0.81
30 0.75
31 0.75
32 0.71
33 0.67
34 0.6
35 0.55
36 0.51
37 0.48
38 0.46
39 0.4
40 0.38
41 0.31
42 0.27
43 0.23
44 0.19
45 0.13
46 0.14
47 0.11
48 0.1
49 0.1
50 0.1
51 0.1
52 0.09
53 0.08
54 0.06
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.07
66 0.06
67 0.08
68 0.08
69 0.08
70 0.12
71 0.13
72 0.18
73 0.21
74 0.23
75 0.26
76 0.29
77 0.28
78 0.26
79 0.31
80 0.28
81 0.26
82 0.25
83 0.22
84 0.28
85 0.29
86 0.33
87 0.34
88 0.32
89 0.31
90 0.32
91 0.33
92 0.31
93 0.38
94 0.4
95 0.44
96 0.49
97 0.53
98 0.59
99 0.57
100 0.54
101 0.49
102 0.48
103 0.45
104 0.39
105 0.36
106 0.3
107 0.31
108 0.28
109 0.25
110 0.17
111 0.1
112 0.11
113 0.09
114 0.11
115 0.16