Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XJJ6

Protein Details
Accession A0A1Y1XJJ6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-72LAPSRWFNKRGKPNRRKSTAGIHydrophilic
NLS Segment(s)
PositionSequence
59-67KRGKPNRRK
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 6, pero 4, cyto 1.5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MEARPQMLSLWVLVACTTNLTPQANVKQNIRKMETIFARRYITSWWILGGLAPSRWFNKRGKPNRRKSTAGIIEITPCSRPMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.09
4 0.09
5 0.09
6 0.12
7 0.13
8 0.13
9 0.17
10 0.25
11 0.3
12 0.32
13 0.37
14 0.41
15 0.44
16 0.49
17 0.48
18 0.43
19 0.37
20 0.41
21 0.42
22 0.4
23 0.37
24 0.35
25 0.33
26 0.3
27 0.29
28 0.25
29 0.21
30 0.16
31 0.14
32 0.12
33 0.1
34 0.1
35 0.1
36 0.1
37 0.08
38 0.07
39 0.08
40 0.1
41 0.12
42 0.15
43 0.18
44 0.21
45 0.3
46 0.4
47 0.5
48 0.61
49 0.69
50 0.78
51 0.85
52 0.87
53 0.83
54 0.77
55 0.77
56 0.74
57 0.67
58 0.58
59 0.48
60 0.45
61 0.42
62 0.38
63 0.28