Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1YTW3

Protein Details
Accession A0A1Y1YTW3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21KFSKDVTSSRRKSRKAHFAAHydrophilic
NLS Segment(s)
PositionSequence
11-18RRKSRKAH
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MKFSKDVTSSRRKSRKAHFAAPSSIRRKIMSASLSKELREKYHARSIPVRKDDEVLVVRGTYKGREGKIVQVYRKKWVIHIERLTREKVNGATTAIGVHPSKVVVTNLKLDKDRKALLARKDRSAKSADAMEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.78
4 0.8
5 0.77
6 0.73
7 0.75
8 0.73
9 0.72
10 0.66
11 0.62
12 0.55
13 0.48
14 0.44
15 0.38
16 0.37
17 0.34
18 0.34
19 0.33
20 0.38
21 0.38
22 0.38
23 0.4
24 0.35
25 0.32
26 0.33
27 0.32
28 0.3
29 0.39
30 0.41
31 0.4
32 0.48
33 0.53
34 0.56
35 0.58
36 0.54
37 0.45
38 0.44
39 0.41
40 0.37
41 0.3
42 0.22
43 0.17
44 0.14
45 0.14
46 0.14
47 0.14
48 0.09
49 0.12
50 0.14
51 0.14
52 0.18
53 0.19
54 0.23
55 0.31
56 0.35
57 0.36
58 0.4
59 0.41
60 0.42
61 0.46
62 0.4
63 0.35
64 0.4
65 0.41
66 0.42
67 0.49
68 0.5
69 0.52
70 0.54
71 0.54
72 0.46
73 0.4
74 0.34
75 0.29
76 0.24
77 0.19
78 0.17
79 0.15
80 0.14
81 0.14
82 0.12
83 0.13
84 0.1
85 0.1
86 0.09
87 0.09
88 0.09
89 0.11
90 0.13
91 0.14
92 0.16
93 0.23
94 0.26
95 0.29
96 0.34
97 0.34
98 0.38
99 0.4
100 0.4
101 0.37
102 0.43
103 0.46
104 0.52
105 0.6
106 0.59
107 0.62
108 0.69
109 0.65
110 0.61
111 0.58
112 0.5
113 0.44