Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1Z8K1

Protein Details
Accession A0A1Y1Z8K1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-121PLDLRHKKTRAIRRRLTKFEATRKTVKQQKKDIHFPQRKFHydrophilic
NLS Segment(s)
PositionSequence
86-112RHKKTRAIRRRLTKFEATRKTVKQQKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAKVSAHELRNKSKDELKKELDELKQELSSLRVQKVAGGAASKLTKINTVRKSIARVLTVITQTERQNIRLLYKQEGRKYLPLDLRHKKTRAIRRRLTKFEATRKTVKQQKKDIHFPQRKFAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.62
4 0.59
5 0.57
6 0.57
7 0.6
8 0.55
9 0.51
10 0.46
11 0.4
12 0.34
13 0.3
14 0.26
15 0.22
16 0.24
17 0.23
18 0.22
19 0.21
20 0.2
21 0.21
22 0.22
23 0.2
24 0.15
25 0.12
26 0.11
27 0.12
28 0.12
29 0.12
30 0.11
31 0.11
32 0.15
33 0.18
34 0.26
35 0.28
36 0.33
37 0.35
38 0.36
39 0.4
40 0.4
41 0.39
42 0.31
43 0.27
44 0.23
45 0.23
46 0.21
47 0.18
48 0.14
49 0.14
50 0.14
51 0.19
52 0.19
53 0.17
54 0.2
55 0.2
56 0.22
57 0.24
58 0.26
59 0.26
60 0.32
61 0.36
62 0.37
63 0.41
64 0.41
65 0.41
66 0.4
67 0.41
68 0.4
69 0.42
70 0.48
71 0.52
72 0.57
73 0.6
74 0.6
75 0.6
76 0.63
77 0.67
78 0.68
79 0.69
80 0.71
81 0.75
82 0.82
83 0.83
84 0.81
85 0.8
86 0.78
87 0.78
88 0.78
89 0.73
90 0.72
91 0.69
92 0.72
93 0.72
94 0.72
95 0.71
96 0.72
97 0.76
98 0.77
99 0.83
100 0.83
101 0.85
102 0.86
103 0.8
104 0.79
105 0.79