Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Z7X5

Protein Details
Accession A0A1Y1Z7X5   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22QEPPVRKKYRAGRRIRAVKVYTHydrophilic
NLS Segment(s)
PositionSequence
7-13KKYRAGR
210-226VQPLKPASGEPKKRRRI
Subcellular Location(s) mito_nucl 11.666, nucl 11.5, mito 11.5, cyto_nucl 8.333, cyto_mito 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR039599  RBM48  
IPR034264  RBM48_RRM  
Gene Ontology GO:0003723  F:RNA binding  
CDD cd12442  RRM_RBM48  
Amino Acid Sequences QEPPVRKKYRAGRRIRAVKVYTVHQESRYLLIERVPALGNTKELLEICSLYGSIEEYRLLDDYPSEEFYDVYWIKYGSLLDARYLVVLSLLIRNEKLIQAYPRMAKRKLDDYVFFGSPLQIRYCPEYETVEDTREKLIDRRRVVSLKTNTPDPLFDGAIAEKALYPEADTVATVEATNPEMLIKPVPKVDHITQSILNIREKLKEASRPVQPLKPASGEPKKRRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.84
4 0.75
5 0.72
6 0.65
7 0.6
8 0.57
9 0.53
10 0.5
11 0.42
12 0.43
13 0.38
14 0.38
15 0.36
16 0.3
17 0.25
18 0.24
19 0.25
20 0.22
21 0.23
22 0.19
23 0.16
24 0.18
25 0.18
26 0.17
27 0.15
28 0.15
29 0.14
30 0.13
31 0.14
32 0.12
33 0.11
34 0.1
35 0.1
36 0.09
37 0.08
38 0.08
39 0.08
40 0.07
41 0.08
42 0.08
43 0.08
44 0.09
45 0.09
46 0.09
47 0.08
48 0.08
49 0.08
50 0.1
51 0.11
52 0.11
53 0.1
54 0.1
55 0.1
56 0.17
57 0.16
58 0.14
59 0.14
60 0.13
61 0.13
62 0.15
63 0.14
64 0.09
65 0.12
66 0.12
67 0.11
68 0.12
69 0.12
70 0.11
71 0.1
72 0.08
73 0.05
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.07
80 0.08
81 0.09
82 0.09
83 0.1
84 0.1
85 0.11
86 0.14
87 0.17
88 0.21
89 0.26
90 0.31
91 0.31
92 0.32
93 0.33
94 0.36
95 0.36
96 0.35
97 0.3
98 0.29
99 0.31
100 0.28
101 0.25
102 0.19
103 0.17
104 0.15
105 0.15
106 0.13
107 0.1
108 0.1
109 0.14
110 0.15
111 0.15
112 0.15
113 0.16
114 0.16
115 0.2
116 0.2
117 0.19
118 0.18
119 0.18
120 0.18
121 0.16
122 0.16
123 0.16
124 0.23
125 0.29
126 0.31
127 0.33
128 0.37
129 0.39
130 0.41
131 0.45
132 0.43
133 0.43
134 0.42
135 0.42
136 0.39
137 0.37
138 0.35
139 0.28
140 0.25
141 0.18
142 0.15
143 0.14
144 0.13
145 0.13
146 0.12
147 0.09
148 0.07
149 0.07
150 0.07
151 0.06
152 0.07
153 0.06
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.08
160 0.07
161 0.07
162 0.07
163 0.08
164 0.08
165 0.07
166 0.07
167 0.08
168 0.09
169 0.12
170 0.13
171 0.14
172 0.18
173 0.19
174 0.21
175 0.27
176 0.29
177 0.34
178 0.35
179 0.37
180 0.34
181 0.37
182 0.4
183 0.36
184 0.35
185 0.3
186 0.29
187 0.3
188 0.32
189 0.33
190 0.34
191 0.38
192 0.43
193 0.47
194 0.53
195 0.57
196 0.59
197 0.6
198 0.59
199 0.56
200 0.53
201 0.5
202 0.47
203 0.48
204 0.54
205 0.59
206 0.64