Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YIU8

Protein Details
Accession A0A1Y1YIU8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
78-118SSLARHKRSHTGKKPYECTFPNCDKRFTRKTTLKKHQTVHHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences RLFQCFLDDCGKTFTRKSDLSRHEKIHTGERPYLCDWEYCGKTFIQRSALAIHYRTHTGERPHSCDYPNCCKSFSDSSSLARHKRSHTGKKPYECTFPNCDKRFTRKTTLKKHQTVHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.36
4 0.4
5 0.44
6 0.52
7 0.58
8 0.63
9 0.62
10 0.58
11 0.59
12 0.57
13 0.56
14 0.52
15 0.5
16 0.49
17 0.45
18 0.46
19 0.42
20 0.42
21 0.33
22 0.28
23 0.25
24 0.26
25 0.26
26 0.23
27 0.22
28 0.2
29 0.23
30 0.25
31 0.25
32 0.21
33 0.2
34 0.2
35 0.21
36 0.23
37 0.21
38 0.2
39 0.19
40 0.16
41 0.17
42 0.17
43 0.16
44 0.17
45 0.19
46 0.26
47 0.27
48 0.32
49 0.34
50 0.35
51 0.34
52 0.35
53 0.39
54 0.41
55 0.43
56 0.38
57 0.36
58 0.35
59 0.38
60 0.4
61 0.35
62 0.3
63 0.28
64 0.3
65 0.37
66 0.42
67 0.4
68 0.38
69 0.41
70 0.39
71 0.47
72 0.53
73 0.57
74 0.61
75 0.69
76 0.73
77 0.78
78 0.81
79 0.76
80 0.74
81 0.67
82 0.63
83 0.6
84 0.61
85 0.63
86 0.58
87 0.61
88 0.59
89 0.65
90 0.68
91 0.67
92 0.68
93 0.67
94 0.75
95 0.8
96 0.84
97 0.86
98 0.85