Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XUR2

Protein Details
Accession A0A1Y1XUR2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
145-181EEPKHKLETKPKSKSKAVPKLKSKPKSESKPKLLAKGBasic
NLS Segment(s)
PositionSequence
148-181KHKLETKPKSKSKAVPKLKSKPKSESKPKLLAKG
Subcellular Location(s) mito 16, extr 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR002223  Kunitz_BPTI  
IPR036880  Kunitz_BPTI_sf  
Gene Ontology GO:0004867  F:serine-type endopeptidase inhibitor activity  
Pfam View protein in Pfam  
PF00014  Kunitz_BPTI  
PROSITE View protein in PROSITE  
PS50279  BPTI_KUNITZ_2  
Amino Acid Sequences MFKIATLATVALAVLSSPLDARMLPEVCQRKGAPGICKASIPSWQFNPATKKCEKFIHGGCGGFVPFTSLEKCQATCNPEPKPKPGPDKLKSCYSPADPGPCRARIRSWHYNKFTQKCEMFLYGGCKGNVPFKSVEDCRQTCEGEEPKHKLETKPKSKSKAVPKLKSKPKSESKPKLLAKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.06
7 0.06
8 0.08
9 0.13
10 0.14
11 0.16
12 0.24
13 0.3
14 0.3
15 0.35
16 0.34
17 0.32
18 0.37
19 0.41
20 0.39
21 0.4
22 0.44
23 0.39
24 0.4
25 0.37
26 0.32
27 0.34
28 0.32
29 0.29
30 0.26
31 0.31
32 0.32
33 0.36
34 0.43
35 0.4
36 0.43
37 0.44
38 0.44
39 0.43
40 0.47
41 0.44
42 0.43
43 0.43
44 0.44
45 0.41
46 0.39
47 0.35
48 0.3
49 0.27
50 0.19
51 0.15
52 0.09
53 0.07
54 0.08
55 0.09
56 0.09
57 0.12
58 0.13
59 0.14
60 0.15
61 0.18
62 0.22
63 0.25
64 0.31
65 0.34
66 0.4
67 0.42
68 0.45
69 0.49
70 0.49
71 0.52
72 0.54
73 0.58
74 0.57
75 0.62
76 0.61
77 0.61
78 0.56
79 0.5
80 0.45
81 0.37
82 0.35
83 0.29
84 0.33
85 0.27
86 0.31
87 0.32
88 0.34
89 0.34
90 0.32
91 0.33
92 0.33
93 0.41
94 0.47
95 0.52
96 0.57
97 0.6
98 0.67
99 0.72
100 0.69
101 0.64
102 0.61
103 0.53
104 0.45
105 0.44
106 0.37
107 0.29
108 0.26
109 0.27
110 0.23
111 0.26
112 0.23
113 0.21
114 0.2
115 0.26
116 0.26
117 0.24
118 0.21
119 0.2
120 0.27
121 0.28
122 0.34
123 0.36
124 0.36
125 0.37
126 0.39
127 0.38
128 0.32
129 0.37
130 0.37
131 0.36
132 0.43
133 0.44
134 0.44
135 0.5
136 0.52
137 0.5
138 0.54
139 0.58
140 0.61
141 0.67
142 0.72
143 0.73
144 0.78
145 0.8
146 0.81
147 0.81
148 0.81
149 0.81
150 0.83
151 0.86
152 0.89
153 0.89
154 0.85
155 0.84
156 0.84
157 0.85
158 0.86
159 0.86
160 0.85
161 0.86