Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WYD8

Protein Details
Accession A0A1Y1WYD8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKEKSTKRSGGKKLSPYNKFHydrophilic
NLS Segment(s)
PositionSequence
57-72ANKKESKEVKESKEPK
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MAKEKSTKRSGGKKLSPYNKFMKTELPKVKAEDPSISHKDAFKVAAGRWKASAENPANKKESKEVKESKEPKESKESKTEEETKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.79
4 0.74
5 0.73
6 0.7
7 0.64
8 0.55
9 0.55
10 0.51
11 0.56
12 0.58
13 0.54
14 0.49
15 0.5
16 0.53
17 0.47
18 0.43
19 0.36
20 0.31
21 0.35
22 0.36
23 0.34
24 0.3
25 0.27
26 0.26
27 0.24
28 0.21
29 0.14
30 0.13
31 0.12
32 0.18
33 0.18
34 0.18
35 0.17
36 0.18
37 0.17
38 0.17
39 0.25
40 0.24
41 0.31
42 0.34
43 0.38
44 0.4
45 0.4
46 0.41
47 0.41
48 0.45
49 0.41
50 0.47
51 0.51
52 0.55
53 0.64
54 0.69
55 0.68
56 0.69
57 0.66
58 0.61
59 0.64
60 0.63
61 0.58
62 0.62
63 0.6
64 0.55
65 0.62