Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XTF5

Protein Details
Accession A0A1Y1XTF5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAKSKNHTNHNQNRKAHRNGIKKPKAQRHPSHydrophilic
NLS Segment(s)
PositionSequence
14-41RKAHRNGIKKPKAQRHPSLRGVDPKFLR
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNRKAHRNGIKKPKAQRHPSLRGVDPKFLRNQRFAKKGTQAAVRAAKESQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.78
5 0.77
6 0.78
7 0.81
8 0.8
9 0.78
10 0.81
11 0.81
12 0.81
13 0.79
14 0.78
15 0.77
16 0.76
17 0.76
18 0.71
19 0.64
20 0.63
21 0.58
22 0.55
23 0.47
24 0.42
25 0.43
26 0.45
27 0.46
28 0.44
29 0.5
30 0.53
31 0.58
32 0.57
33 0.57
34 0.57
35 0.59
36 0.57
37 0.55
38 0.49
39 0.5
40 0.55
41 0.49
42 0.44