Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PP60

Protein Details
Accession B8PP60    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
75-96VTPPDRARCKRRVNEAPRRGNAHydrophilic
196-226PSGFVANKPGRQKRRRPKTQDCPTRGRSPKAHydrophilic
NLS Segment(s)
PositionSequence
203-213KPGRQKRRRPK
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3
Family & Domain DBs
KEGG ppl:POSPLDRAFT_101872  -  
Amino Acid Sequences MTTNLQPRQTSIRPRTVHEQIREGGFGLCEPQKVPEGLPGAASQRRYEQHNGVLRGFDGPMGRRDGGWAQALKAVTPPDRARCKRRVNEAPRRGNARTGCYSESRHFARVFLGPAGSKCLIGSDNQHDSGANQDNAKPVTFGRVTWIAAEAGRATLTLPPTLGSVTRRFKILENADISARVQGTPRSNNTMRASSPSGFVANKPGRQKRRRPKTQDCPTRGRSPKAFPKTAETNGELKKPSEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.66
3 0.67
4 0.68
5 0.62
6 0.6
7 0.54
8 0.54
9 0.49
10 0.41
11 0.32
12 0.24
13 0.19
14 0.18
15 0.16
16 0.14
17 0.14
18 0.15
19 0.18
20 0.18
21 0.19
22 0.2
23 0.21
24 0.21
25 0.21
26 0.2
27 0.22
28 0.24
29 0.25
30 0.21
31 0.24
32 0.26
33 0.3
34 0.34
35 0.34
36 0.39
37 0.46
38 0.48
39 0.43
40 0.41
41 0.36
42 0.31
43 0.27
44 0.2
45 0.15
46 0.13
47 0.15
48 0.19
49 0.19
50 0.17
51 0.2
52 0.19
53 0.2
54 0.22
55 0.2
56 0.16
57 0.19
58 0.19
59 0.17
60 0.17
61 0.17
62 0.15
63 0.2
64 0.22
65 0.27
66 0.38
67 0.43
68 0.49
69 0.56
70 0.64
71 0.66
72 0.73
73 0.76
74 0.76
75 0.81
76 0.84
77 0.84
78 0.78
79 0.77
80 0.68
81 0.63
82 0.55
83 0.5
84 0.43
85 0.37
86 0.35
87 0.31
88 0.34
89 0.29
90 0.32
91 0.29
92 0.29
93 0.26
94 0.24
95 0.23
96 0.21
97 0.21
98 0.16
99 0.14
100 0.11
101 0.11
102 0.15
103 0.13
104 0.11
105 0.09
106 0.1
107 0.09
108 0.1
109 0.13
110 0.13
111 0.15
112 0.16
113 0.16
114 0.15
115 0.15
116 0.19
117 0.19
118 0.16
119 0.14
120 0.14
121 0.17
122 0.18
123 0.18
124 0.14
125 0.1
126 0.14
127 0.13
128 0.12
129 0.14
130 0.15
131 0.15
132 0.15
133 0.16
134 0.12
135 0.11
136 0.12
137 0.08
138 0.06
139 0.06
140 0.06
141 0.05
142 0.07
143 0.08
144 0.08
145 0.08
146 0.08
147 0.08
148 0.09
149 0.1
150 0.11
151 0.18
152 0.22
153 0.23
154 0.24
155 0.25
156 0.26
157 0.34
158 0.35
159 0.34
160 0.31
161 0.32
162 0.31
163 0.3
164 0.29
165 0.22
166 0.18
167 0.12
168 0.11
169 0.14
170 0.2
171 0.25
172 0.28
173 0.34
174 0.36
175 0.42
176 0.45
177 0.45
178 0.4
179 0.4
180 0.41
181 0.34
182 0.34
183 0.28
184 0.27
185 0.24
186 0.23
187 0.28
188 0.28
189 0.33
190 0.41
191 0.5
192 0.57
193 0.67
194 0.77
195 0.78
196 0.84
197 0.9
198 0.91
199 0.92
200 0.93
201 0.94
202 0.94
203 0.9
204 0.88
205 0.84
206 0.84
207 0.8
208 0.77
209 0.73
210 0.72
211 0.75
212 0.75
213 0.74
214 0.66
215 0.67
216 0.66
217 0.65
218 0.61
219 0.54
220 0.53
221 0.51
222 0.54
223 0.49