Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y191

Protein Details
Accession A0A1Y1Y191    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
103-130TPGEAHKYYSKRKNLRRNQPKLMRLRALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009360  Isy1  
Gene Ontology GO:0000350  P:generation of catalytic spliceosome for second transesterification step  
Pfam View protein in Pfam  
PF06246  Isy1  
Amino Acid Sequences MARNSEKQLSGLNRFLRAQEDEFLKEKIQKRPPLKTLNTAAEVRSWIPSIKKDISYCLHHLSGVRNYSEKKIAEFRERLQFLEREYERFVKKVRELDPDAIGTPGEAHKYYSKRKNLRRNQPKLMRLRAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.37
4 0.35
5 0.31
6 0.29
7 0.29
8 0.29
9 0.31
10 0.31
11 0.29
12 0.32
13 0.36
14 0.41
15 0.46
16 0.51
17 0.56
18 0.64
19 0.7
20 0.72
21 0.7
22 0.68
23 0.65
24 0.61
25 0.57
26 0.49
27 0.42
28 0.33
29 0.31
30 0.24
31 0.19
32 0.15
33 0.12
34 0.13
35 0.15
36 0.2
37 0.21
38 0.24
39 0.23
40 0.27
41 0.29
42 0.32
43 0.32
44 0.3
45 0.27
46 0.24
47 0.25
48 0.24
49 0.24
50 0.21
51 0.19
52 0.18
53 0.19
54 0.2
55 0.24
56 0.21
57 0.18
58 0.23
59 0.26
60 0.31
61 0.32
62 0.34
63 0.38
64 0.38
65 0.37
66 0.34
67 0.32
68 0.26
69 0.33
70 0.31
71 0.24
72 0.27
73 0.31
74 0.29
75 0.3
76 0.32
77 0.29
78 0.33
79 0.37
80 0.38
81 0.41
82 0.44
83 0.45
84 0.44
85 0.39
86 0.35
87 0.29
88 0.24
89 0.16
90 0.13
91 0.11
92 0.12
93 0.1
94 0.13
95 0.19
96 0.26
97 0.36
98 0.44
99 0.53
100 0.6
101 0.71
102 0.79
103 0.83
104 0.88
105 0.9
106 0.91
107 0.91
108 0.91
109 0.9
110 0.89