Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WVJ7

Protein Details
Accession A0A1Y1WVJ7    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-32GYPAIRYKRHLPKKGPSGLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 8, mito 7, cyto 5.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009346  GRIM-19  
Gene Ontology GO:0005747  C:mitochondrial respiratory chain complex I  
Pfam View protein in Pfam  
PF06212  GRIM-19  
Amino Acid Sequences MSTYNQELPPQGGYPAIRYKRHLPKKGPSGLVLFTGLAAITGISFYQVFEGIKERRELKREKIWARLHLLPMLQAEYDRDAYRRQYAAFVREAEIMKDVPGWEVGKSVYNTKRYIAPNIIIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.29
3 0.34
4 0.34
5 0.38
6 0.48
7 0.56
8 0.66
9 0.7
10 0.68
11 0.71
12 0.78
13 0.81
14 0.74
15 0.65
16 0.58
17 0.5
18 0.43
19 0.34
20 0.24
21 0.16
22 0.13
23 0.1
24 0.07
25 0.05
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.06
37 0.11
38 0.12
39 0.13
40 0.16
41 0.2
42 0.22
43 0.28
44 0.31
45 0.33
46 0.4
47 0.47
48 0.48
49 0.53
50 0.54
51 0.52
52 0.54
53 0.5
54 0.43
55 0.36
56 0.32
57 0.24
58 0.21
59 0.17
60 0.12
61 0.09
62 0.09
63 0.09
64 0.11
65 0.1
66 0.11
67 0.12
68 0.15
69 0.19
70 0.2
71 0.18
72 0.22
73 0.25
74 0.27
75 0.28
76 0.27
77 0.25
78 0.28
79 0.27
80 0.22
81 0.21
82 0.18
83 0.15
84 0.15
85 0.13
86 0.1
87 0.12
88 0.12
89 0.11
90 0.12
91 0.12
92 0.16
93 0.18
94 0.25
95 0.29
96 0.33
97 0.34
98 0.35
99 0.42
100 0.41
101 0.46
102 0.44