Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VQB7

Protein Details
Accession A0A1Y1VQB7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-61MNAVRIRKENQKAKKENKIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040466  NKAP  
IPR009269  NKAP_C  
Gene Ontology GO:0003682  F:chromatin binding  
Pfam View protein in Pfam  
PF06047  Nkap_C  
Amino Acid Sequences MAAYVQSGKRIPRRGEIGLTSNQIETYEDVGYVMSGSRHHRMNAVRIRKENQKAKKENKIIADFRELVADRVKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.5
4 0.46
5 0.42
6 0.41
7 0.34
8 0.28
9 0.24
10 0.2
11 0.17
12 0.14
13 0.12
14 0.1
15 0.09
16 0.08
17 0.08
18 0.08
19 0.07
20 0.06
21 0.04
22 0.06
23 0.09
24 0.11
25 0.13
26 0.13
27 0.18
28 0.19
29 0.28
30 0.35
31 0.41
32 0.44
33 0.46
34 0.5
35 0.55
36 0.62
37 0.63
38 0.64
39 0.65
40 0.7
41 0.75
42 0.81
43 0.8
44 0.76
45 0.75
46 0.74
47 0.67
48 0.61
49 0.59
50 0.5
51 0.43
52 0.43
53 0.36
54 0.29
55 0.31