Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1Y4K6

Protein Details
Accession A0A1Y1Y4K6    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-27VSLPGVNGKKRPRRKFDEIERLYHydrophilic
57-79RLPSEFKELRKHWKKQRQVVGENHydrophilic
NLS Segment(s)
PositionSequence
13-18KKRPRR
Subcellular Location(s) mito 16, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MFSFVSLPGVNGKKRPRRKFDEIERLYSCNYQGCTKSYGTLNHLNAHVMMQKHGVKRLPSEFKELRKHWKKQRQVVGEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.7
4 0.74
5 0.81
6 0.84
7 0.86
8 0.87
9 0.79
10 0.77
11 0.69
12 0.62
13 0.54
14 0.44
15 0.34
16 0.25
17 0.23
18 0.19
19 0.18
20 0.19
21 0.2
22 0.2
23 0.21
24 0.21
25 0.21
26 0.23
27 0.27
28 0.27
29 0.25
30 0.25
31 0.23
32 0.21
33 0.2
34 0.18
35 0.12
36 0.11
37 0.14
38 0.18
39 0.2
40 0.24
41 0.27
42 0.25
43 0.3
44 0.38
45 0.42
46 0.4
47 0.48
48 0.49
49 0.54
50 0.62
51 0.61
52 0.64
53 0.65
54 0.73
55 0.75
56 0.8
57 0.82
58 0.83
59 0.89