Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VUE0

Protein Details
Accession A0A1Y1VUE0    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
90-121LLNPRYAKSARTRCQKRKRHPAQAPGPSRRCSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 11, nucl 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
Gene Ontology GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PROSITE View protein in PROSITE  
PS51186  GNAT  
Amino Acid Sequences MTSIRRFTTGDLFKFNNINLDVLTETYNISFYLSYLARWPDIFYVTESPNKTLMGYIMGKTEGRNKEWHGHVTALTVAPEYRRLVFTNQLLNPRYAKSARTRCQKRKRHPAQAPGPSRRCSILLNLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.34
4 0.27
5 0.25
6 0.19
7 0.19
8 0.17
9 0.15
10 0.16
11 0.11
12 0.1
13 0.09
14 0.1
15 0.08
16 0.08
17 0.07
18 0.06
19 0.1
20 0.1
21 0.1
22 0.13
23 0.14
24 0.14
25 0.14
26 0.15
27 0.12
28 0.14
29 0.14
30 0.13
31 0.15
32 0.16
33 0.21
34 0.21
35 0.21
36 0.21
37 0.2
38 0.18
39 0.15
40 0.13
41 0.12
42 0.12
43 0.11
44 0.1
45 0.11
46 0.11
47 0.11
48 0.19
49 0.17
50 0.18
51 0.2
52 0.21
53 0.27
54 0.29
55 0.3
56 0.25
57 0.23
58 0.22
59 0.2
60 0.19
61 0.13
62 0.11
63 0.09
64 0.07
65 0.07
66 0.09
67 0.1
68 0.1
69 0.11
70 0.13
71 0.15
72 0.2
73 0.23
74 0.28
75 0.29
76 0.35
77 0.34
78 0.35
79 0.34
80 0.3
81 0.32
82 0.26
83 0.27
84 0.31
85 0.4
86 0.47
87 0.57
88 0.66
89 0.73
90 0.82
91 0.89
92 0.9
93 0.91
94 0.93
95 0.93
96 0.91
97 0.91
98 0.91
99 0.91
100 0.89
101 0.88
102 0.84
103 0.75
104 0.68
105 0.6
106 0.52
107 0.43