Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y0F1

Protein Details
Accession A0A1Y1Y0F1   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKAKRQKQYKKCMQVYQNTFGHydrophilic
176-207NKANPTTQTKEPPKPKKKKAKAPNPLSCKKKKHydrophilic
NLS Segment(s)
PositionSequence
186-207EPPKPKKKKAKAPNPLSCKKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
IPR029060  PIN-like_dom_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04900  Fcf1  
CDD cd08553  PIN_Fcf1-like  
Amino Acid Sequences MKAKRQKQYKKCMQVYQNTFGFREPYQVIVDGDFCQAALDSRINLKEQVPKTLLGQAKPMYTTCGLAELREKGEDFLGTVIAMKRFEKRRCPHKTPISSAECLSEIIGKDNQHNYCIATQNTQLRSSFRQIPGVPLLYLNRSVMILEPPSGKTLEKVAQVERAKTLPSAQELAFLNKANPTTQTKEPPKPKKKKAKAPNPLSCKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.79
4 0.73
5 0.64
6 0.57
7 0.49
8 0.43
9 0.33
10 0.31
11 0.24
12 0.22
13 0.21
14 0.22
15 0.21
16 0.19
17 0.2
18 0.16
19 0.15
20 0.13
21 0.11
22 0.09
23 0.08
24 0.08
25 0.09
26 0.09
27 0.09
28 0.13
29 0.15
30 0.16
31 0.18
32 0.2
33 0.26
34 0.26
35 0.32
36 0.3
37 0.29
38 0.3
39 0.35
40 0.35
41 0.27
42 0.31
43 0.26
44 0.26
45 0.26
46 0.24
47 0.21
48 0.18
49 0.19
50 0.14
51 0.17
52 0.16
53 0.15
54 0.18
55 0.17
56 0.17
57 0.17
58 0.17
59 0.13
60 0.13
61 0.13
62 0.1
63 0.08
64 0.07
65 0.06
66 0.07
67 0.07
68 0.08
69 0.09
70 0.09
71 0.16
72 0.23
73 0.28
74 0.37
75 0.43
76 0.53
77 0.61
78 0.68
79 0.72
80 0.74
81 0.76
82 0.72
83 0.72
84 0.66
85 0.58
86 0.51
87 0.42
88 0.32
89 0.26
90 0.2
91 0.13
92 0.09
93 0.1
94 0.12
95 0.11
96 0.13
97 0.18
98 0.18
99 0.17
100 0.18
101 0.17
102 0.17
103 0.2
104 0.18
105 0.15
106 0.18
107 0.24
108 0.25
109 0.26
110 0.24
111 0.23
112 0.26
113 0.28
114 0.32
115 0.27
116 0.31
117 0.3
118 0.33
119 0.33
120 0.31
121 0.27
122 0.21
123 0.21
124 0.16
125 0.17
126 0.14
127 0.11
128 0.1
129 0.1
130 0.09
131 0.1
132 0.1
133 0.1
134 0.12
135 0.12
136 0.14
137 0.14
138 0.14
139 0.12
140 0.16
141 0.18
142 0.21
143 0.22
144 0.23
145 0.31
146 0.33
147 0.33
148 0.31
149 0.28
150 0.25
151 0.23
152 0.24
153 0.19
154 0.2
155 0.22
156 0.19
157 0.23
158 0.24
159 0.27
160 0.27
161 0.24
162 0.22
163 0.21
164 0.23
165 0.18
166 0.21
167 0.23
168 0.27
169 0.32
170 0.42
171 0.48
172 0.57
173 0.67
174 0.74
175 0.79
176 0.85
177 0.9
178 0.91
179 0.93
180 0.94
181 0.94
182 0.94
183 0.94
184 0.94
185 0.94
186 0.92
187 0.91