Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1W6C9

Protein Details
Accession A0A1Y1W6C9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-83QQKYPDYKYSPNRTKTKRKQSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 14, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences KIPRPANCFFLFRREKQSEIFASNPGITNMEVSRIIGKMWKNISAEEKSKYQWMAEQIKLDHQQKYPDYKYSPNRTKTKRKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.46
4 0.51
5 0.44
6 0.41
7 0.39
8 0.31
9 0.29
10 0.27
11 0.25
12 0.19
13 0.16
14 0.12
15 0.12
16 0.11
17 0.11
18 0.1
19 0.1
20 0.1
21 0.09
22 0.09
23 0.11
24 0.12
25 0.15
26 0.16
27 0.19
28 0.19
29 0.2
30 0.24
31 0.25
32 0.27
33 0.25
34 0.25
35 0.22
36 0.24
37 0.23
38 0.19
39 0.18
40 0.23
41 0.26
42 0.27
43 0.29
44 0.28
45 0.33
46 0.4
47 0.4
48 0.37
49 0.33
50 0.38
51 0.39
52 0.47
53 0.45
54 0.45
55 0.45
56 0.5
57 0.58
58 0.62
59 0.67
60 0.68
61 0.75
62 0.77
63 0.85