Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YAV1

Protein Details
Accession A0A1Y1YAV1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSERRTRRRPRQNVSAAHYVGHydrophilic
NLS Segment(s)
PositionSequence
157-171RKRNRKTGLPGERRG
Subcellular Location(s) nucl 14, mito 7.5, cyto_mito 5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007757  MT-A70-like  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0090304  P:nucleic acid metabolic process  
Pfam View protein in Pfam  
PF05063  MT-A70  
PROSITE View protein in PROSITE  
PS51143  MT_A70  
Amino Acid Sequences MSERRTRRRPRQNVSAAHYVGYVEDNESVEAIMKKFEELEKIQSEIAKSNAQKVATESETVDTNPDAVAAVSEDVVPSTNENGAEQGLTEEQLEEVFKQTSVFTVRSAITNEDIDAVDDLEIWRMDMANGDTAEFEEEDDYLAVDDDFWDEEFGVSRKRNRKTGLPGERRGRLDKESILQRYRIMHVRLQDRNGNFFMVKKKVSAIDPSLPTYVKIPAVPIPRSWVHTICEKKPIEERIPGSRYYEQNITSLNLSTLGKQFQVIYMDPPLVLPNEEPSPGKITLEQLAALEISRIVPVGFLFVWIEKEYLPDIVQIADKWGFKYVENFCWIKKNINNQIACQPSAYFRKSKLSLLIFRKEGDIELRHQRNPDCVFDFIKPLQEDEVSERKPEFIYDVIETMLPTALYSEEYPNGERMLELWAKKNTRRQGWTTVVDQSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.73
4 0.63
5 0.53
6 0.42
7 0.33
8 0.26
9 0.19
10 0.11
11 0.12
12 0.12
13 0.12
14 0.12
15 0.11
16 0.13
17 0.15
18 0.14
19 0.14
20 0.14
21 0.14
22 0.16
23 0.18
24 0.21
25 0.22
26 0.29
27 0.29
28 0.31
29 0.32
30 0.31
31 0.31
32 0.28
33 0.28
34 0.28
35 0.27
36 0.32
37 0.35
38 0.33
39 0.32
40 0.32
41 0.35
42 0.29
43 0.3
44 0.24
45 0.21
46 0.22
47 0.21
48 0.2
49 0.14
50 0.13
51 0.11
52 0.1
53 0.08
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.08
66 0.1
67 0.1
68 0.1
69 0.11
70 0.11
71 0.1
72 0.09
73 0.09
74 0.08
75 0.08
76 0.08
77 0.07
78 0.07
79 0.08
80 0.08
81 0.07
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.12
88 0.15
89 0.15
90 0.13
91 0.16
92 0.17
93 0.18
94 0.2
95 0.19
96 0.17
97 0.17
98 0.16
99 0.15
100 0.14
101 0.13
102 0.11
103 0.1
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.06
110 0.06
111 0.06
112 0.06
113 0.08
114 0.08
115 0.1
116 0.1
117 0.1
118 0.1
119 0.1
120 0.12
121 0.09
122 0.09
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.07
140 0.08
141 0.12
142 0.15
143 0.22
144 0.3
145 0.35
146 0.42
147 0.44
148 0.51
149 0.56
150 0.64
151 0.68
152 0.68
153 0.71
154 0.7
155 0.73
156 0.68
157 0.61
158 0.54
159 0.45
160 0.4
161 0.34
162 0.34
163 0.35
164 0.37
165 0.35
166 0.33
167 0.33
168 0.32
169 0.33
170 0.33
171 0.28
172 0.25
173 0.29
174 0.36
175 0.38
176 0.38
177 0.4
178 0.35
179 0.37
180 0.35
181 0.3
182 0.22
183 0.22
184 0.24
185 0.23
186 0.22
187 0.19
188 0.2
189 0.21
190 0.22
191 0.23
192 0.21
193 0.23
194 0.24
195 0.25
196 0.25
197 0.23
198 0.21
199 0.19
200 0.17
201 0.12
202 0.11
203 0.1
204 0.14
205 0.18
206 0.19
207 0.18
208 0.21
209 0.21
210 0.24
211 0.25
212 0.21
213 0.18
214 0.25
215 0.29
216 0.26
217 0.34
218 0.31
219 0.31
220 0.35
221 0.39
222 0.35
223 0.36
224 0.37
225 0.36
226 0.38
227 0.37
228 0.36
229 0.35
230 0.33
231 0.31
232 0.31
233 0.24
234 0.23
235 0.23
236 0.2
237 0.16
238 0.15
239 0.12
240 0.11
241 0.1
242 0.11
243 0.12
244 0.12
245 0.11
246 0.11
247 0.11
248 0.11
249 0.13
250 0.12
251 0.12
252 0.12
253 0.12
254 0.11
255 0.11
256 0.11
257 0.08
258 0.09
259 0.07
260 0.08
261 0.09
262 0.11
263 0.11
264 0.12
265 0.16
266 0.15
267 0.16
268 0.14
269 0.15
270 0.17
271 0.17
272 0.16
273 0.11
274 0.11
275 0.11
276 0.1
277 0.08
278 0.05
279 0.05
280 0.04
281 0.05
282 0.04
283 0.04
284 0.04
285 0.06
286 0.06
287 0.06
288 0.07
289 0.07
290 0.09
291 0.09
292 0.1
293 0.08
294 0.1
295 0.1
296 0.1
297 0.1
298 0.09
299 0.09
300 0.09
301 0.1
302 0.09
303 0.11
304 0.14
305 0.14
306 0.14
307 0.18
308 0.18
309 0.18
310 0.25
311 0.26
312 0.27
313 0.32
314 0.32
315 0.29
316 0.36
317 0.37
318 0.37
319 0.38
320 0.44
321 0.49
322 0.56
323 0.56
324 0.51
325 0.57
326 0.53
327 0.49
328 0.39
329 0.3
330 0.28
331 0.34
332 0.35
333 0.3
334 0.29
335 0.38
336 0.39
337 0.41
338 0.43
339 0.44
340 0.49
341 0.53
342 0.57
343 0.5
344 0.48
345 0.46
346 0.39
347 0.33
348 0.3
349 0.26
350 0.24
351 0.33
352 0.37
353 0.38
354 0.42
355 0.42
356 0.45
357 0.46
358 0.47
359 0.4
360 0.38
361 0.39
362 0.36
363 0.4
364 0.33
365 0.36
366 0.3
367 0.28
368 0.27
369 0.25
370 0.25
371 0.26
372 0.34
373 0.28
374 0.3
375 0.29
376 0.29
377 0.28
378 0.27
379 0.23
380 0.17
381 0.19
382 0.19
383 0.19
384 0.18
385 0.18
386 0.17
387 0.15
388 0.13
389 0.09
390 0.07
391 0.07
392 0.07
393 0.09
394 0.11
395 0.13
396 0.16
397 0.18
398 0.2
399 0.21
400 0.21
401 0.19
402 0.17
403 0.15
404 0.19
405 0.22
406 0.23
407 0.28
408 0.36
409 0.42
410 0.49
411 0.58
412 0.6
413 0.64
414 0.7
415 0.69
416 0.7
417 0.72
418 0.71
419 0.65