Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1W2P8

Protein Details
Accession A0A1Y1W2P8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
162-190YPAPVAPVKVKKEKKKHNKKPTAVDPAVTHydrophilic
NLS Segment(s)
PositionSequence
170-182KVKKEKKKHNKKP
Subcellular Location(s) cyto 18.5, cyto_nucl 14.333, nucl 7, mito_nucl 4.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
IPR014729  Rossmann-like_a/b/a_fold  
IPR002307  Tyr-tRNA-ligase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016740  F:transferase activity  
GO:0004831  F:tyrosine-tRNA ligase activity  
GO:0006437  P:tyrosyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
Amino Acid Sequences ALDEEYLGVDAQFGGVDQRKIFTFAEKYLPHLGYKKRAHLMNPMVPGLTGSKMSASDVDSKLDLLDEPKTVEKKIKKAFCEEGNVTENGVLSFVKYVLLPISSLNGKEANFTILRPEKYGGNVVYTNYEALEADFANKEIHPGRFEEVFEDPELRKLADLAYPAPVAPVKVKKEKKKHNKKPTAVDPAVTGKLHPPRLSTEAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.15
4 0.15
5 0.17
6 0.18
7 0.21
8 0.22
9 0.23
10 0.24
11 0.24
12 0.32
13 0.31
14 0.34
15 0.38
16 0.38
17 0.35
18 0.38
19 0.41
20 0.43
21 0.47
22 0.5
23 0.5
24 0.52
25 0.51
26 0.54
27 0.57
28 0.53
29 0.51
30 0.44
31 0.38
32 0.34
33 0.33
34 0.24
35 0.17
36 0.12
37 0.09
38 0.09
39 0.09
40 0.1
41 0.1
42 0.11
43 0.16
44 0.16
45 0.17
46 0.17
47 0.17
48 0.16
49 0.15
50 0.13
51 0.08
52 0.09
53 0.08
54 0.1
55 0.14
56 0.15
57 0.16
58 0.23
59 0.26
60 0.33
61 0.41
62 0.45
63 0.44
64 0.49
65 0.53
66 0.49
67 0.51
68 0.43
69 0.39
70 0.36
71 0.34
72 0.28
73 0.23
74 0.19
75 0.12
76 0.11
77 0.07
78 0.04
79 0.05
80 0.04
81 0.04
82 0.04
83 0.05
84 0.04
85 0.05
86 0.05
87 0.05
88 0.06
89 0.07
90 0.07
91 0.08
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.1
98 0.1
99 0.15
100 0.18
101 0.19
102 0.19
103 0.2
104 0.18
105 0.2
106 0.23
107 0.17
108 0.16
109 0.16
110 0.15
111 0.16
112 0.15
113 0.14
114 0.1
115 0.1
116 0.07
117 0.06
118 0.07
119 0.05
120 0.06
121 0.07
122 0.07
123 0.08
124 0.08
125 0.11
126 0.13
127 0.15
128 0.14
129 0.16
130 0.18
131 0.18
132 0.19
133 0.19
134 0.18
135 0.18
136 0.17
137 0.19
138 0.16
139 0.18
140 0.19
141 0.16
142 0.14
143 0.13
144 0.13
145 0.13
146 0.14
147 0.12
148 0.13
149 0.13
150 0.13
151 0.14
152 0.13
153 0.12
154 0.17
155 0.23
156 0.27
157 0.37
158 0.47
159 0.56
160 0.66
161 0.76
162 0.82
163 0.86
164 0.91
165 0.93
166 0.94
167 0.93
168 0.93
169 0.92
170 0.91
171 0.81
172 0.71
173 0.63
174 0.58
175 0.53
176 0.42
177 0.33
178 0.29
179 0.36
180 0.41
181 0.38
182 0.35
183 0.38