Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y0V2

Protein Details
Accession A0A1Y1Y0V2   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-67GTPNKTKSSKRTQNKERDSSHydrophilic
83-104GTKNKKMTKEDKAKSRKEKAEEBasic
NLS Segment(s)
PositionSequence
90-99TKEDKAKSRK
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
Amino Acid Sequences MPPANTKKNPQIKTPSRVKHHPYASPAKLNTPSKGLQTVTRGTPGSSGTPNKTKSSKRTQNKERDSSLRDELNGLIGEVYSFGTKNKKMTKEDKAKSRKEKAEEYEALEKDFDSALEHFAVLGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.73
4 0.79
5 0.77
6 0.76
7 0.73
8 0.7
9 0.67
10 0.67
11 0.65
12 0.63
13 0.57
14 0.53
15 0.55
16 0.52
17 0.46
18 0.41
19 0.37
20 0.32
21 0.35
22 0.31
23 0.26
24 0.27
25 0.28
26 0.25
27 0.26
28 0.24
29 0.21
30 0.21
31 0.19
32 0.17
33 0.18
34 0.2
35 0.21
36 0.27
37 0.29
38 0.31
39 0.36
40 0.38
41 0.41
42 0.49
43 0.56
44 0.59
45 0.67
46 0.73
47 0.78
48 0.81
49 0.79
50 0.73
51 0.68
52 0.62
53 0.56
54 0.5
55 0.4
56 0.32
57 0.27
58 0.23
59 0.19
60 0.16
61 0.11
62 0.07
63 0.06
64 0.06
65 0.05
66 0.06
67 0.04
68 0.05
69 0.06
70 0.11
71 0.13
72 0.2
73 0.27
74 0.33
75 0.4
76 0.48
77 0.57
78 0.63
79 0.69
80 0.72
81 0.75
82 0.78
83 0.81
84 0.83
85 0.8
86 0.76
87 0.77
88 0.73
89 0.72
90 0.66
91 0.62
92 0.6
93 0.53
94 0.48
95 0.39
96 0.33
97 0.25
98 0.22
99 0.16
100 0.11
101 0.11
102 0.12
103 0.12
104 0.12