Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WVM0

Protein Details
Accession A0A1Y1WVM0   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
388-409ASLRKVDRSKLRRPAVQNRGELHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 11.333, cyto 11, mito 10.5, cyto_nucl 8.333, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
IPR036936  CRIB_dom_sf  
IPR011993  PH-like_dom_sf  
IPR039056  SPEC  
IPR011026  WAS_C  
IPR033927  WASPfam_EVH1  
IPR000697  WH1/EVH1_dom  
IPR003124  WH2_dom  
Gene Ontology GO:0030479  C:actin cortical patch  
GO:0005634  C:nucleus  
GO:0005886  C:plasma membrane  
GO:0003779  F:actin binding  
GO:0031267  F:small GTPase binding  
GO:0007015  P:actin filament organization  
GO:0008360  P:regulation of cell shape  
GO:0035023  P:regulation of Rho protein signal transduction  
Pfam View protein in Pfam  
PF00786  PBD  
PF00568  WH1  
PROSITE View protein in PROSITE  
PS50108  CRIB  
PS50229  WH1  
PS51082  WH2  
CDD cd00132  CRIB  
cd01205  EVH1_WASP-like  
Amino Acid Sequences MPSLTLANVEDKARVKRCVGSGTNKILTATVAELYVASEVDGKSSWEVTGKCGALALVRDQLVDKFHFRLVGLKDEEGILWEMELEPGFEYVQERAYFHSFHLEGKLMAFSFAEEHEAHVFYQKVLSRERLGNRQRLKKSRSLQEKKSPVEGPSLMNYCPGFIFSLGNPVGLASLLVGPSKPKLDKSMIGTPSNFRHVGHVGFNPELGFDVQNVDPEWSQLFEELGKYGLTMDRLNTKQTRRFIYDFVEAHGGPTGEGNPAEVTAKVMADPLSPPGSPSQAALPPPPPPPPPMPSLPTPALTPTPEPPADLPTTVPVTDKPLSAVPGRLTGIRGSVSSSDLLSSIRGVGGVKGLRHIELQQNEVRVTASDPNLRDTLLSNIRNAGGVASLRKVDRSKLRRPAVQNRGELAEALASALSQRSRVLALSDSEAEPEESDESDWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.43
4 0.47
5 0.51
6 0.53
7 0.53
8 0.56
9 0.6
10 0.6
11 0.55
12 0.51
13 0.42
14 0.35
15 0.28
16 0.21
17 0.14
18 0.1
19 0.1
20 0.09
21 0.09
22 0.09
23 0.08
24 0.06
25 0.09
26 0.09
27 0.1
28 0.1
29 0.11
30 0.12
31 0.13
32 0.13
33 0.15
34 0.16
35 0.18
36 0.24
37 0.23
38 0.22
39 0.21
40 0.21
41 0.18
42 0.19
43 0.19
44 0.16
45 0.16
46 0.17
47 0.17
48 0.19
49 0.2
50 0.21
51 0.21
52 0.19
53 0.2
54 0.21
55 0.21
56 0.26
57 0.26
58 0.31
59 0.31
60 0.28
61 0.28
62 0.27
63 0.26
64 0.21
65 0.2
66 0.11
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.07
73 0.06
74 0.07
75 0.07
76 0.07
77 0.08
78 0.08
79 0.13
80 0.13
81 0.13
82 0.16
83 0.18
84 0.19
85 0.18
86 0.24
87 0.2
88 0.21
89 0.23
90 0.21
91 0.18
92 0.18
93 0.2
94 0.13
95 0.12
96 0.11
97 0.08
98 0.08
99 0.08
100 0.11
101 0.09
102 0.11
103 0.12
104 0.13
105 0.13
106 0.15
107 0.15
108 0.12
109 0.16
110 0.17
111 0.19
112 0.21
113 0.24
114 0.25
115 0.31
116 0.36
117 0.42
118 0.46
119 0.52
120 0.58
121 0.64
122 0.69
123 0.72
124 0.73
125 0.72
126 0.74
127 0.74
128 0.77
129 0.76
130 0.76
131 0.77
132 0.8
133 0.73
134 0.71
135 0.64
136 0.53
137 0.5
138 0.42
139 0.34
140 0.3
141 0.29
142 0.23
143 0.23
144 0.22
145 0.17
146 0.15
147 0.14
148 0.1
149 0.08
150 0.1
151 0.07
152 0.14
153 0.14
154 0.14
155 0.13
156 0.12
157 0.11
158 0.1
159 0.1
160 0.03
161 0.04
162 0.04
163 0.05
164 0.05
165 0.05
166 0.07
167 0.1
168 0.1
169 0.11
170 0.15
171 0.18
172 0.22
173 0.27
174 0.35
175 0.35
176 0.36
177 0.36
178 0.35
179 0.34
180 0.34
181 0.28
182 0.2
183 0.19
184 0.19
185 0.2
186 0.2
187 0.19
188 0.17
189 0.17
190 0.17
191 0.14
192 0.12
193 0.11
194 0.09
195 0.07
196 0.05
197 0.08
198 0.07
199 0.08
200 0.09
201 0.09
202 0.08
203 0.09
204 0.09
205 0.07
206 0.07
207 0.06
208 0.06
209 0.05
210 0.06
211 0.05
212 0.06
213 0.05
214 0.05
215 0.05
216 0.06
217 0.07
218 0.07
219 0.08
220 0.13
221 0.14
222 0.18
223 0.23
224 0.26
225 0.31
226 0.36
227 0.39
228 0.39
229 0.4
230 0.38
231 0.38
232 0.39
233 0.34
234 0.3
235 0.29
236 0.23
237 0.21
238 0.2
239 0.16
240 0.09
241 0.09
242 0.09
243 0.07
244 0.07
245 0.07
246 0.06
247 0.06
248 0.07
249 0.06
250 0.07
251 0.06
252 0.07
253 0.06
254 0.07
255 0.07
256 0.07
257 0.07
258 0.09
259 0.1
260 0.1
261 0.11
262 0.11
263 0.12
264 0.12
265 0.12
266 0.13
267 0.14
268 0.16
269 0.17
270 0.18
271 0.2
272 0.22
273 0.25
274 0.23
275 0.24
276 0.27
277 0.28
278 0.31
279 0.32
280 0.33
281 0.32
282 0.36
283 0.34
284 0.31
285 0.28
286 0.26
287 0.24
288 0.22
289 0.21
290 0.18
291 0.21
292 0.2
293 0.21
294 0.2
295 0.22
296 0.21
297 0.2
298 0.18
299 0.16
300 0.17
301 0.16
302 0.16
303 0.13
304 0.18
305 0.18
306 0.18
307 0.17
308 0.17
309 0.19
310 0.2
311 0.22
312 0.17
313 0.19
314 0.2
315 0.19
316 0.18
317 0.16
318 0.17
319 0.15
320 0.14
321 0.12
322 0.13
323 0.13
324 0.12
325 0.12
326 0.11
327 0.1
328 0.1
329 0.09
330 0.08
331 0.07
332 0.06
333 0.07
334 0.07
335 0.07
336 0.11
337 0.13
338 0.13
339 0.16
340 0.17
341 0.18
342 0.19
343 0.22
344 0.25
345 0.25
346 0.29
347 0.29
348 0.31
349 0.3
350 0.29
351 0.26
352 0.19
353 0.19
354 0.2
355 0.21
356 0.24
357 0.25
358 0.28
359 0.28
360 0.28
361 0.25
362 0.22
363 0.25
364 0.29
365 0.29
366 0.26
367 0.28
368 0.28
369 0.28
370 0.26
371 0.19
372 0.12
373 0.13
374 0.14
375 0.14
376 0.17
377 0.17
378 0.22
379 0.23
380 0.29
381 0.37
382 0.43
383 0.51
384 0.59
385 0.66
386 0.7
387 0.77
388 0.81
389 0.8
390 0.81
391 0.75
392 0.68
393 0.63
394 0.55
395 0.47
396 0.36
397 0.27
398 0.18
399 0.14
400 0.1
401 0.07
402 0.07
403 0.1
404 0.09
405 0.09
406 0.1
407 0.11
408 0.13
409 0.14
410 0.15
411 0.16
412 0.18
413 0.21
414 0.24
415 0.22
416 0.22
417 0.23
418 0.21
419 0.18
420 0.17
421 0.14
422 0.12