Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Z255

Protein Details
Accession A0A1Y1Z255    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-76DSKSRSRSTQYKNNNNRHGKPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR007921  CHAP_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF05257  CHAP  
PROSITE View protein in PROSITE  
PS50911  CHAP  
Amino Acid Sequences MNPTFFLCTLAVIISSCLIQATLSTNPHPNDLQPRYYYSYKYSWSSNGGDSGGNDDSKSRSRSTQYKNNNNRHGKPGSSKNNGYSGTQDKGRLVFQFDNGQCTDWADARYAQLTGHHVSWSGDARTWANKARNTPGWSVSTRPIKPSIIVLQPGVQGAGGAGHVAVVESIKSNGEVYTSNYNYNGGPYVKTYTTFESGYGISYIWYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.06
5 0.06
6 0.05
7 0.06
8 0.09
9 0.13
10 0.16
11 0.18
12 0.25
13 0.25
14 0.29
15 0.29
16 0.29
17 0.35
18 0.37
19 0.39
20 0.36
21 0.39
22 0.42
23 0.44
24 0.43
25 0.37
26 0.37
27 0.36
28 0.36
29 0.34
30 0.31
31 0.33
32 0.33
33 0.29
34 0.26
35 0.23
36 0.21
37 0.19
38 0.2
39 0.17
40 0.15
41 0.13
42 0.13
43 0.15
44 0.19
45 0.22
46 0.19
47 0.22
48 0.28
49 0.37
50 0.44
51 0.51
52 0.57
53 0.66
54 0.74
55 0.8
56 0.84
57 0.82
58 0.78
59 0.75
60 0.67
61 0.59
62 0.56
63 0.56
64 0.55
65 0.54
66 0.52
67 0.48
68 0.5
69 0.48
70 0.42
71 0.36
72 0.31
73 0.26
74 0.26
75 0.25
76 0.2
77 0.2
78 0.21
79 0.17
80 0.17
81 0.16
82 0.15
83 0.22
84 0.22
85 0.23
86 0.22
87 0.22
88 0.18
89 0.18
90 0.17
91 0.1
92 0.11
93 0.09
94 0.09
95 0.09
96 0.1
97 0.09
98 0.08
99 0.08
100 0.1
101 0.11
102 0.11
103 0.11
104 0.11
105 0.11
106 0.13
107 0.14
108 0.11
109 0.11
110 0.11
111 0.12
112 0.14
113 0.16
114 0.2
115 0.24
116 0.26
117 0.28
118 0.33
119 0.39
120 0.4
121 0.4
122 0.38
123 0.36
124 0.35
125 0.34
126 0.35
127 0.37
128 0.34
129 0.35
130 0.35
131 0.32
132 0.31
133 0.32
134 0.31
135 0.26
136 0.26
137 0.24
138 0.23
139 0.23
140 0.22
141 0.18
142 0.12
143 0.08
144 0.07
145 0.06
146 0.04
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.04
156 0.05
157 0.06
158 0.07
159 0.07
160 0.07
161 0.09
162 0.1
163 0.13
164 0.21
165 0.23
166 0.24
167 0.24
168 0.25
169 0.24
170 0.24
171 0.24
172 0.16
173 0.16
174 0.17
175 0.22
176 0.22
177 0.24
178 0.25
179 0.26
180 0.28
181 0.28
182 0.25
183 0.23
184 0.22
185 0.22
186 0.19
187 0.14